SecReT4
Protein ID: 121593656
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1252
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1330470..1331417 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDA1W5F1
KEGG IDajs:Ajs_1252
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.3e-93, Aligned region: 33..303
Protein Sequence: 315 a.a.     [Download]
>gi|121593656|ref|YP_985552.1| hypothetical protein Ajs_1252 [Acidovorax sp. JS42]
MTRPFDLLRRLRVPVASLLLATATGSYALNTATIVSSVMSPDCLEYRVVGICYWLYCTYGGCSVRTSVKV
RHYVPDAVVSSYSNTGENPWVEVQAMSTPNPSAQAGGDGTTNEDHENDLAKFKNADVIGHPGGEVFNQFA
SSSGYFCQGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALIPGMREVGARTTMNLWGNVYPRGGFLHQTD
DHKSGAVVAQRAGDVVTRRGQLHVYQPLLANARDGYWPAGALVEGDTSTGKWQELTPRLSNTCVVFPHSG
TLTQAQQGDYAWALWRPYACCERRGQVFLGSVDFL
 
Nucleotide Sequence: 948 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1331417-1330470 Acidovorax sp. JS42 chromosome, complete genome
ATGACGCGCCCATTCGATCTGCTGCGCCGCCTGCGCGTGCCCGTGGCCTCGCTGCTGCTGGCCACCGCCA
CAGGCAGCTACGCCTTGAACACCGCCACGATCGTCTCGTCCGTCATGTCGCCGGACTGCCTGGAGTACCG
GGTGGTGGGCATCTGCTACTGGCTGTACTGCACCTATGGCGGCTGCTCGGTGCGCACGTCGGTCAAGGTC
AGGCACTACGTGCCCGATGCGGTCGTCTCCAGCTACAGCAACACCGGCGAGAACCCCTGGGTCGAGGTGC
AGGCGATGAGCACGCCCAACCCATCCGCCCAAGCAGGCGGCGACGGAACCACGAACGAAGACCACGAGAA
CGACCTCGCCAAGTTCAAGAACGCCGACGTGATCGGCCACCCTGGCGGGGAGGTGTTCAACCAGTTCGCG
TCGTCCTCCGGCTACTTCTGCCAAGGCGCGGGCACGGCCTTCATGCCGTATCTGCTCAGCACCCTGGACA
CGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAGGCGTTGATTCCGGGCATGCGTGAGGT
CGGTGCGCGCACCACGATGAACCTCTGGGGCAATGTCTATCCACGCGGTGGCTTCCTGCACCAGACCGAC
GACCACAAATCCGGGGCGGTGGTGGCCCAGCGCGCGGGCGATGTCGTCACGCGCCGCGGGCAGTTGCACG
TGTACCAGCCACTGCTCGCCAACGCCCGTGACGGCTACTGGCCGGCCGGGGCGCTGGTCGAAGGCGATAC
CTCCACCGGGAAGTGGCAGGAGCTGACCCCTCGTCTGTCGAACACCTGCGTGGTCTTCCCCCACAGCGGC
ACGCTGACCCAGGCCCAGCAAGGCGACTACGCCTGGGCGCTGTGGCGGCCGTATGCCTGCTGCGAACGCC
GCGGGCAGGTGTTCCTGGGCAGCGTCGATTTCCTCTGA
 Primer design