SecReT4
Protein ID: 121593657
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1253
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1331414..1331860 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDA1W5F2
KEGG IDajs:Ajs_1253, ajs:Ajs_1395
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.3e-39, Aligned region: 35..145
Protein Sequence: 148 a.a.     [Download]
>gi|121593657|ref|YP_985553.1| hypothetical protein Ajs_1253 [Acidovorax sp. JS42]
MPAAFIRFAPSWRTLGLAVALPVSLAVFSPATFAADVVVVTDSRHPVKTMGGERLIELDETPRMEAELSA
NLPADPERAAAIVRQGLNQGGADLQRRIAMAYQGVTDAWSLGVTTIPAVVVDQRYVVYGEPDVARAIARI
KQHRRAQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1331860-1331414 Acidovorax sp. JS42 chromosome, complete genome
ATGCCAGCAGCTTTTATCCGGTTCGCACCAAGCTGGCGAACCCTTGGCCTGGCCGTAGCGCTGCCGGTGT
CTCTGGCGGTGTTCAGCCCGGCCACCTTCGCCGCCGACGTGGTGGTCGTCACCGACAGCCGCCACCCGGT
CAAGACCATGGGTGGCGAGCGACTGATCGAGTTGGACGAAACGCCCCGGATGGAGGCCGAGCTTTCCGCG
AATCTTCCAGCCGACCCTGAGCGGGCAGCAGCCATCGTCCGGCAAGGCCTGAACCAGGGAGGCGCCGACC
TTCAGCGCCGCATCGCGATGGCCTACCAAGGCGTGACCGACGCATGGAGTTTGGGTGTCACGACCATCCC
GGCCGTGGTGGTGGACCAGCGCTATGTGGTCTATGGCGAGCCGGACGTCGCCCGCGCCATCGCGCGCATC
AAGCAGCACCGGAGGGCGCAGCCATGA
 Primer design