SecReT4
Protein ID: 121593660
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1256
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1333487..1336378 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDA1W5F5
KEGG IDajs:Ajs_1256
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.5e-65, Aligned region: 64..343
AAA_10 [PF12846], Evalue: 4.5e-46, Aligned region: 537..876
Protein Sequence: 963 a.a.     [Download]
>gi|121593660|ref|YP_985556.1| hypothetical protein Ajs_1256 [Acidovorax sp. JS42]
MRWKLPWPKLAGAGSSSPASDEQPDSWQRHVEALRQAGIPEPGSAVHGRKPATVADEQALYDVAPSFVEL
LPWVEFMPESKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQ
DEPSFDQYMQTLRDYVQPRARGSAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYR
RASGQGQANRRGQTPEQMLGIVCDRLCGGLANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGVEDRERF
YALARYPDSTEESEAGEIELASGRDFSQRLFFGQPRSDVAQGAWYFDGMPHRVLITDRLRMPPGTGHLTG
ETRKGDAINTLFDQMPEDTLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVHEARSLIGSAHK
LYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRRWYTQL
MFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQ
VTAIYRPRLFIVEAGNSFGLFSDFAKRLGLTVNRVKLAPGSGISLAPFADARRLIETPSDVQTLDADALD
EDLPPDASAMEADEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTR
DVRNALRTRGQDPTLPEMRRARLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQ
LSIAYISLISTVNNIAERDQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDL
PRAAEPMLNMIEWWVCLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAVPP
SLYLALAQTEPEEKAERYQLMQQHGVSELDAAFKVAEKIDRARGIESPTLDLP
 
Nucleotide Sequence: 2892 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1336378-1333487 Acidovorax sp. JS42 chromosome, complete genome
ATGCGGTGGAAACTCCCATGGCCGAAGCTGGCCGGCGCCGGCTCCAGTAGCCCGGCCAGCGATGAGCAGC
CGGACAGCTGGCAGCGCCACGTCGAGGCCTTGCGCCAGGCCGGCATCCCCGAACCCGGTTCGGCAGTCCA
CGGCCGCAAGCCAGCGACCGTGGCCGACGAGCAGGCGCTGTACGACGTTGCGCCGTCCTTCGTGGAACTG
CTGCCCTGGGTGGAGTTCATGCCCGAGTCGAAATCGATGCTCCTGGAGGACGGCCAATCGGTGGCGGCGT
TCTACGAGCTGGTGCCGCTGGGCACCGAAGGCCGGGAACCCGGCTGGCTCGCGCATGCCCGCGACGCCCT
GGAAAACGCGCTTCAGGACAGTTTCGATGAACTGGACGAGAACCCGTGGGTGCTCCAGCTCTATGCCCAG
GACGAACCGAGCTTCGACCAGTACATGCAGACCTTGCGCGATTACGTGCAGCCACGTGCGCGCGGCTCGG
CGTTCACCGAGTTCTACCTGCGCTTCTTCGGCCACCACCTGCGCGCTGTGGCCAAGCCCGGCGGCCTGTT
CGAGGACACGGTGGTCACGCGGCTGCGCTGGCGCGGCCAGACGCGGCGCGTGCGCATGGTGGTGTACCGC
CGCGCGAGCGGACAGGGACAGGCAAACCGCCGCGGCCAGACACCCGAGCAGATGCTGGGCATCGTCTGCG
ACCGCCTGTGCGGCGGCCTGGCGAACGCCGGCATCCAGGCCCGGCGCATGGTCGCGGCCGACGTCCACGA
CTGGCTGCTGCGGTGGTTCAACCCGCGCCCCACGCTGCTCGGGCCTGGGGTGGAGGACCGGGAGCGCTTC
TACGCGTTGGCGCGCTATCCGGACAGTACCGAGGAAAGCGAGGCCGGCGAGATCGAGCTGGCGAGCGGGC
GGGATTTCAGCCAGCGGCTGTTCTTTGGGCAGCCGCGCTCGGACGTGGCGCAAGGGGCCTGGTACTTCGA
CGGCATGCCGCACCGCGTGCTGATCACCGACCGGCTGCGCATGCCGCCCGGCACCGGGCACCTGACCGGC
GAGACCCGCAAGGGGGACGCGATCAACACGCTGTTCGACCAGATGCCCGAGGACACCTTGATGTGTCTCA
CGATGGTCGCCACGCCGCAGGATGTGCTGGAAGCGGACTTGAACCACCTGGCGAAGAAGGCCGTGGGCGA
GACGCTGGCGTCGGAGCAGACGCTCAAGGACGTGCATGAAGCCCGCTCCCTGATCGGCAGCGCGCACAAG
CTCTACCGGGGCACTCTGGCGTTCTACCTACGCGGGCGCGACGAGGCGGAACTGGATCGGCGCGGCCTGG
ACCTCGCGAACGTGATGCTCAACGCCGGCCTGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCGCTCAA
CAGCTACCTGCGCTGGCTGCCGTGCTGCTACAACCCCGGCCAGGATCGGCGCCGGTGGTACACGCAACTG
ATGTTCGCCCAGCATGCGGCGAACCTGTCGCCGGTGTGGGGCCGCGCCCAGGGCACGGGGCATCCCGGCA
TCACGATGTTCAATCGCGGCGGCGGCCCGATCACGTTCGATCCGCTCAACCGCCTAGACCGACAGATGAA
CGCCCACTTGTTCCTGTTCGGCCCCACCGGCTCCGGCAAGAGCGCCACGCTCAACAACCTATTGAATCAG
GTCACGGCCATCTACCGGCCAAGGCTGTTCATCGTGGAAGCCGGCAACAGCTTCGGCCTGTTCAGCGACT
TCGCCAAGCGCCTGGGCCTGACCGTGAACCGGGTCAAGCTGGCCCCCGGATCGGGCATCAGCCTGGCGCC
GTTCGCCGACGCACGCCGGCTGATCGAAACGCCCAGCGACGTGCAGACGCTCGATGCCGATGCGCTGGAC
GAAGACCTGCCACCGGATGCCTCGGCCATGGAGGCGGATGAGCAGCGCGACGTGCTGGGCGAACTGGAGA
TCACGGCACGGCTGATGATCACGGGCGGCGAAGACAAGGAAGAAGCGCGGATGACGCGGGCCGACCGCTC
GCTGATCCGCCAGTGCATCCTCGACGCCGCCGAACATTGCGTGGCGGAGAAGCGCACCGTGCTCACGCGC
GATGTGCGCAATGCACTGCGCACCCGTGGCCAGGACCCGACGTTGCCCGAGATGCGCCGTGCGCGGCTGC
TGGAGATGGCGGACGCGATGGACATGTTCTGCCAAGGCACGGACGGCGAGATGTTCGACCGCGACGGCAC
GCCGTGGCCCGAGGCCGACATCACGCTGGTCGATCTGGCGACCTATGCCCGCGAGGGCTACAACGCGCAG
CTCTCCATCGCCTACATCAGCCTGATCAGCACGGTGAACAACATCGCCGAGCGCGACCAGTACCTGGGAC
GGCCGATCGTCAACGTGACCGACGAAGGTCACATCATCACCAAGAACCCGCTGCTCGCGCCCTATGTCGT
GAAAATTACAAAAATGTGGCGCAAGTTGGGCGCCTGGTTCTGGCTGGCGACGCAGAACATCGACGACCTG
CCACGTGCAGCGGAGCCGATGCTCAACATGATCGAGTGGTGGGTGTGCCTGTCGATGCCGCCGGACGAGG
TGGAGAAGATCGCGCGCTTCCGCGAACTCTCGCCGGCGCAGAAGGCGCTGATGCTCTCCGCACGCAAGGA
AGCGGGCAAGTTCACCGAGGGCGTCATCCTCTCCAAGAGCATGGAAGTGCTGTTCCGCGCCGTGCCGCCA
AGTCTCTACCTCGCGCTCGCGCAAACCGAGCCCGAGGAGAAGGCAGAACGCTACCAACTCATGCAGCAGC
ACGGCGTCAGCGAGCTGGATGCCGCCTTCAAGGTGGCTGAGAAGATCGACCGGGCACGTGGCATCGAGTC
GCCGACCCTGGACCTGCCCTGA
 Primer design