SecReT4
Protein ID: 121593661
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1257
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1336378..1336827 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDA1W5F6
KEGG IDajs:Ajs_1257
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|121593661|ref|YP_985557.1| hypothetical protein Ajs_1257 [Acidovorax sp. JS42]
MHSNLTNLARGLALALAVAVLGGCATSKEKLLTHGDRTMMDIWQQEAGDGGGAAGRNAGRQLLDARQSLR
RPLTDADVQAAPVEQMRYTRTARNEVHRQFQRLPNPDLVMYVYPHLAGTDPVPVPGYTTVFPLYQRIQYA
MPGERVEDY
 
Nucleotide Sequence: 450 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1336827-1336378 Acidovorax sp. JS42 chromosome, complete genome
ATGCACTCGAACTTGACTAACCTGGCCCGTGGCCTGGCACTGGCCCTCGCCGTCGCGGTGCTCGGCGGCT
GCGCCACCAGCAAGGAAAAGCTGCTGACCCACGGTGACCGCACGATGATGGACATCTGGCAGCAGGAGGC
CGGCGACGGCGGTGGCGCAGCCGGACGGAACGCCGGCCGCCAGCTGCTCGACGCGCGCCAGAGCCTGCGT
CGGCCCCTGACCGACGCCGACGTGCAGGCCGCACCTGTCGAGCAGATGCGCTACACGCGCACCGCGCGCA
ATGAGGTCCACCGCCAGTTCCAGCGCCTGCCCAATCCCGATCTCGTGATGTACGTGTACCCGCACCTGGC
CGGCACCGATCCCGTGCCGGTGCCCGGCTACACGACCGTCTTCCCGCTCTACCAGCGCATCCAGTACGCG
ATGCCGGGCGAGCGCGTGGAGGACTACTGA
 Primer design