SecReT4
Protein ID: 121593662
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1258
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1336808..1338238 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDA1W5F7
KEGG IDajs:Ajs_1258
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|121593662|ref|YP_985558.1| hypothetical protein Ajs_1258 [Acidovorax sp. JS42]
MRSNGLLKWLMIPVAILVLFVGIRLFSGGGSTAPPAEDNGAQLTPDEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQEQAASARQQTEGLLADLQRRL
DSIGGRGGGHADLPVGLGLQGGDEAGMEGGVRWVEPDDAKPAEGRNGGRGASGGMSFPTSFGPAQSTLET
TAETVANAGARAAGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDREGNQQDNQQQNSQSGGLGWISDPHG
IPCVSGERRSNAQQYLGSQALITAAGAGVASLIESDSGRMSYVGSDGSIGTVGITGQEAVGQILAGGVRD
MSAWVNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGKSHALELD
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1338238-1336808 Acidovorax sp. JS42 chromosome, complete genome
ATGCGCAGTAACGGCCTGCTCAAGTGGCTGATGATCCCTGTCGCCATCCTGGTGCTGTTCGTCGGTATCC
GGCTGTTCTCGGGTGGAGGCAGCACGGCGCCACCCGCGGAGGACAACGGCGCCCAGCTCACGCCCGATGA
AATGAAGGCTCTCGGCATCGAGGGCGATACCCCGCGCGACACCGTGGCGACCTTGGTGGCGCAGGTGAAG
CAGTTGCGCACCGAGCTTCAGACCGCGCTCTCGGACAACAAGTCCCAGCGTGAAGAGAACCAGCGGCTGC
GTCAGCGCGAAAACTCCATCGACCAGCGCATCAACTCGGCGCTCGAATCCGAGCGGTCCAACCTGCGCCG
CGACCAGGAGCAGGCGGCCAGCGCGCGCCAGCAGACCGAAGGGCTGCTCGCCGACCTGCAGCGGCGCCTG
GACAGCATCGGCGGGCGCGGCGGCGGCCATGCGGACCTGCCCGTGGGCTTGGGGCTGCAGGGCGGCGACG
AGGCCGGCATGGAGGGCGGCGTGCGGTGGGTCGAGCCGGACGACGCAAAGCCCGCCGAGGGGCGCAACGG
GGGGCGTGGCGCGAGCGGCGGCATGAGCTTCCCCACGAGCTTCGGCCCGGCGCAGAGCACGCTCGAAACC
ACCGCGGAAACCGTGGCCAACGCGGGCGCCCGCGCCGCCGGGGTCAAGAGTGCCAAGCCGGTCTATACCG
TGCCGACCAACTCGACGCTGATGGGATCGGTGGCGATGACGGCCCTGATCGGCCGCGTGCCGATCGACGG
CACGGTCAACGATCCCTATCCGTTCAAAGTCCTGGTCGGGCCGGACAACCTGACCGCCAATGGCATCGAC
ATTCCCGACGTGGCCGGCGCCGTGTTCAGCGGCACCGCCTCGGGCGACTGGACGCTGTCGTGCGTGCGCG
GTCAGGTGCGCAGCATCACGTTCGTCTTCCACGACGGCACGATCCGCACGATCCCCGAAGACCGCGAGGG
CAACCAGCAGGACAACCAACAGCAGAACTCTCAAAGTGGGGGCTTGGGCTGGATCAGCGATCCCCACGGC
ATCCCGTGCGTCAGCGGCGAGCGGCGCAGCAACGCCCAGCAATACCTCGGCTCGCAGGCCCTGATCACCG
CGGCCGGTGCCGGTGTGGCCTCGCTCATCGAGAGCGACAGCGGCCGCATGTCCTATGTCGGCTCGGACGG
CTCCATCGGCACCGTGGGCATCACCGGCCAGGAAGCGGTCGGCCAGATTCTGGCGGGCGGCGTGCGGGAC
ATGTCGGCCTGGGTCAACAAGTTGTACGGCCAGGCATTCGCCGCCGTCTATGTTCAGCCCGGCGCCAAGG
TGGCCGTCCACCTCGAAAAGCCGCTCGCCATCGACTTCGATCCCGAAGGCCGCAAGGTCGATCACCGCGC
AGGAAAAAGCCATGCACTCGAACTTGACTAA
 Primer design