SecReT4
Protein ID: 121593663
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1259
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1338228..1339136 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDA1W5F8
KEGG IDajs:Ajs_1259, ajs:Ajs_1401
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.7e-125, Aligned region: 7..283
Protein Sequence: 302 a.a.     [Download]
>gi|121593663|ref|YP_985559.1| hypothetical protein Ajs_1259 [Acidovorax sp. JS42]
MKHPVLALLGLLAVAAAPVAHAVEILRWERMPLAVPLKVGQERIVFIDRDVRVGVPAGVGERLRVQSAGG
AVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGSSTPARYGDQAGGADDAPAR
AQAGARTARRETPVPVVLTRFAAQNLYAPLRTVEPLPGVMRVNLPRDLDLDTLMPTLPVRAVALASWRLE
DQWVTAVRLTNGSGGWITLDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTRGRGLAQSLLPAIHRF
DPALHLPQPDGDENTKEARHAQ
 
Nucleotide Sequence: 909 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1339136-1338228 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGCACCCTGTACTCGCGCTGCTGGGACTGCTGGCCGTGGCCGCGGCACCCGTCGCCCATGCAGTGG
AAATCCTGCGCTGGGAGCGCATGCCGCTGGCAGTGCCGCTGAAGGTCGGTCAGGAACGCATCGTGTTCAT
CGACCGGGACGTGCGCGTGGGCGTGCCCGCGGGCGTGGGCGAGCGCCTCCGCGTACAGAGCGCGGGCGGC
GCGGTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACGCGGTTGCAACTGCAGGACGCCGACACGGGCG
CGCTGATCCTGCTGGACATCGCGGCCGAACCACCCAAGGACGGCGAGGCCGAGCTGGAGCCGGTGCGCAT
CGTCGAGGGCAGCAGCACTCCAGCGCGCTACGGCGATCAGGCAGGCGGCGCCGACGATGCCCCAGCACGT
GCCCAGGCAGGTGCTCGGACCGCGCGGCGCGAAACCCCGGTCCCTGTCGTCCTGACGCGCTTCGCCGCGC
AGAACCTCTACGCGCCGTTGCGCACCGTGGAGCCGCTGCCGGGCGTCATGCGGGTCAACCTGCCCCGCGA
CCTCGACCTGGACACACTGATGCCAACGCTGCCCGTGCGCGCGGTCGCGCTCGCGTCGTGGCGCCTGGAG
GACCAGTGGGTCACAGCCGTGCGCCTGACCAACGGCAGCGGCGGCTGGATCACGCTCGACCCGCGCGTGC
TGCAAGGCGATTTCCTCACCGCCACCTTCCAGCACGAGGCGCTGGGCCCGCGCGGCACGCCCGAGGACAC
GACCGTCCTGTACCTGGTCACGCGCGGCCGCGGCCTCGCGCAGTCGCTGCTGCCGGCGATTCACCGCTTC
GACCCTGCCCTGCATCTGCCGCAGCCGGACGGCGACGAGAACACCAAGGAGGCCCGCCATGCGCAGTAA
 Primer design