SecReT4
Protein ID: 121593664
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1260
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1339133..1339825 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDA1W5F9
KEGG IDajs:Ajs_1260, ajs:Ajs_1402
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.2e-89, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|121593664|ref|YP_985560.1| hypothetical protein Ajs_1260 [Acidovorax sp. JS42]
MSRFKNEIAHLQAHIKTLRLGAGALVVVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYPRNLHTLSPYLTPSCQAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRTVSDRDWVVTLDITADEYYGAEQVKRALVRYPIKVTRVDVDPARNPFGLALDCYDGAPQRISAPE
PTRPAPSGLSPQAPQGGNTP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1339825-1339133 Acidovorax sp. JS42 chromosome, complete genome
ATGAGCCGCTTCAAGAACGAGATCGCCCACCTGCAGGCGCACATCAAGACCTTGCGGCTGGGCGCGGGCG
CGCTGGTCGTCGTTGCCCTGGTCATGGGCGGCGGCTGGTGGAGCGCGCCGCGCGACCTGACCATCCACGT
CCCGCCCGACCTGCGCTCTGGCAGTACCCGCAAGTGGTGGGAGGTGCCGCCCGAATCGGTCTATGCGTTC
ACGTTCTACGTGTTCCAGACGTTGAACCGCTGGCCGACCAATGGCGAAGAGGACTACCCGCGCAACCTCC
ACACGCTCTCGCCGTACCTCACCCCATCCTGCCAGGCCTTCCTGCGGGCGGACTACGACTACCGCCGCTC
CACCGGCGAGCTGCGCCAGCGCGTGCGCGGCATCTACGAGATTCCCGGCCGCGGCTATGGCGACGACCCC
ACGGCACGCGTGCGCACCGTGTCCGACCGCGACTGGGTGGTGACGCTGGACATCACGGCGGACGAGTACT
ACGGCGCCGAGCAGGTCAAGCGCGCCCTGGTGCGCTATCCGATCAAGGTCACGCGGGTGGATGTCGATCC
CGCCCGCAACCCGTTCGGCCTGGCGCTGGACTGCTACGACGGCGCGCCCCAGCGCATCAGTGCACCGGAG
CCGACGCGCCCGGCGCCGAGTGGCCTGTCTCCGCAAGCGCCTCAAGGAGGAAACACCCCATGA
 Primer design