SecReT4
Protein ID: 121593665
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1261
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1339822..1340220 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA1W5G0
KEGG IDajs:Ajs_1261, ajs:Ajs_1403
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 5.8e-48, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|121593665|ref|YP_985561.1| hypothetical protein Ajs_1261 [Acidovorax sp. JS42]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIALAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIVTRHPLMAGWVGGHVLISRSGFWSTRRSMR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1340220-1339822 Acidovorax sp. JS42 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACCGTGACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTCGTGCGCGGCCTCACCGCCGATGAACTCTGGATTTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGCGCGCCCCTGTCCTGGGTGTTCCGCACGATCGCGCTGGCGCCGACGTTCGTCGTCCTGGGT
GTGGCGCTCGGCGTCTTCATCGGCGGCGGCATCCTGCGCCGCCTCAAGCGTGGGCGTCCCGACACTTGGC
TGTATCGACAACTGCAATGGCGCATCGTCACGCGCCATCCGCTGATGGCAGGCTGGGTTGGTGGCCATGT
GCTGATCTCGCGCTCGGGCTTCTGGTCCACCCGCAGGAGCATGCGATGA
 Primer design