SecReT4
Protein ID: 121593668
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1264
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1340838..1341221 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA1W5G3
KEGG IDajs:Ajs_1264
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.3e-30, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|121593668|ref|YP_985564.1| hypothetical protein Ajs_1264 [Acidovorax sp. JS42]
MVASIWLRAAHRGVPTFLVTALLLGLSQMALAESPAQRQKLVAALRQLDALERTVADSAAHAPIQPGERY
HFDYPRLLADLARVRAGIQFHLTPSRAQPRDPSELAGDYRTERAAEPLPATTAGGKQ
 
Nucleotide Sequence: 384 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1341221-1340838 Acidovorax sp. JS42 chromosome, complete genome
ATGGTGGCTTCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCCTGC
TGGGTCTGTCCCAGATGGCCTTGGCCGAGTCTCCGGCACAGCGCCAGAAGCTGGTCGCCGCACTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCGGACAGCGCCGCGCATGCCCCCATCCAGCCGGGCGAGCGCTAC
CACTTCGACTACCCGCGGCTGCTGGCTGACCTGGCGCGCGTTCGCGCCGGCATCCAGTTTCACCTGACGC
CATCGCGCGCTCAGCCGCGCGACCCCTCCGAACTGGCCGGCGACTACCGCACCGAGCGGGCGGCCGAGCC
GCTGCCGGCGACGACTGCGGGGGGCAAGCAATGA
 Primer design