SecReT4
Protein ID: 121593677
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1273
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1348704..1349453 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1W5H2
KEGG IDajs:Ajs_1273
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.1e-69, Aligned region: 47..246
Protein Sequence: 249 a.a.     [Download]
>gi|121593677|ref|YP_985573.1| hypothetical protein Ajs_1273 [Acidovorax sp. JS42]
MKDAASTAQREQNHRQGLIVGTITLPFRLLGVLIGSLLFSIVVECAGMHLFWKDQGWRHSQQMLRYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERVRSASHGQSRNFRYYISQVYVWAES
YLIAAAFTTLTFLVRLLVLVLTLPLILTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WVTYLALPISVHPLVILLPSAALLGMAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1349453-1348704 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCATCGCCAAGGCTTGATCGTCGGCACCATCA
CCTTACCGTTCCGGCTGCTCGGGGTGCTCATTGGCTCGCTGCTGTTTTCGATCGTGGTGGAGTGCGCCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGCCACTCCCAGCAGATGCTGCGGTACGAACTCGGGCAC
CTGTCCAACCACTTCACGCGCAGCGTGGTGGTACAGGAGCCCGGGCGCACGGCGCACGAGTTGGTGGATA
CCGGGTACGAGTGGGTGTTCGTGCGCTCGGGGTTGCTGGAGCGCATGAGCCAGACCGCCGAGCGCGTCCG
CTCGGCCAGCCACGGGCAGAGCCGCAACTTCCGCTACTACATCAGCCAAGTCTATGTCTGGGCCGAAAGC
TACCTGATCGCTGCGGCCTTCACGACGCTCACCTTCCTGGTGCGCCTGCTGGTCCTGGTGCTCACGCTGC
CCCTGATCCTCACGGCGGCATTCGTCGGCCTGATTGACGGCCTGGTGCGACGGGATGTGCGCCGGTTCGG
CGCCGGCCGCGAATCCGGCTTCATCTACCACCGCGCGAAGGCCAGCCTGATGCCGTTGGCCGTGCTGCCT
TGGGTCACCTATCTCGCTCTGCCCATATCGGTGCATCCTCTGGTCATCCTGCTGCCCAGCGCGGCGTTGC
TGGGGATGGCAGTCAGCCTGACCGCAGGCAGCTTCAAGAAGTACTTATGA
 Primer design