SecReT4
Protein ID: 121593678
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1274
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1349450..1351642 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDA1W5H3
KEGG IDajs:Ajs_1274
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.5e-14, Aligned region: 507..637
AAA_10 [PF12846], Evalue: 2e-09, Aligned region: 191..584
TrwB_AAD_bind [PF10412], Evalue: 2e-09, Aligned region: 509..649
Protein Sequence: 730 a.a.     [Download]
>gi|121593678|ref|YP_985574.1| hypothetical protein Ajs_1274 [Acidovorax sp. JS42]
MSGKQPVEVLLRPAVELYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYRDARVILRYRR
NIRRLPRYVMTSRDVPVSQQRLFVGRGFLWEQKHTHRLMQTYRPEFRRYAEPTPAYRLARRLEERLEFAP
LPLSRLPKLTGWDVPFNPVRPLPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFV
TQDIRRRNAAGEHEVVIVIDPKGDADLLKRMYVEAQRAGREGEFYVFHLGWPDISARYNAVGRFGRISEV
ATRVAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYMLIQRHVINIDALFIEYAQHYFAKTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAVVYVGLDALSDAEVAAAVGNSMFSDLVSVAGHIYK
HGIDDGLPGASAGARVPINVHADEFNELMGDEFIPLINKGGGAGLQVTAYTQTLSDIEARIGNRAKAGQV
IGNFNNLFMLRVRETATAELLTRQLPKVEVYTTTIVSGATDSSDIRGATDFTSNTQDRISMSSVPMIEPS
HVVGLPKGQCFALLQGGQLWKVRMPLPAPDPDEVMPADLQQLAGYMRQSYSEATQWWEFTSSSALQDAAL
PDDLLDDAAAAEPGAVATGADDGAGNEAVP
 
Nucleotide Sequence: 2193 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1351642-1349450 Acidovorax sp. JS42 chromosome, complete genome
ATGTCGGGGAAACAGCCAGTTGAGGTACTGCTTCGCCCAGCGGTGGAGCTATATACCGTCGCGGCGTGTG
CAGGCGCCGCGTTTCTGTCCCTGGTGGCACCCTGGTCGCTCGCGCTGAGCCCCGCCATGGGCGTCGGCAG
CGCGCTGGCGTTCGGGGCCTACGGCGCCATCCGCTACCGCGATGCCCGGGTCATCCTGCGCTACCGGCGC
AACATCCGCCGCCTGCCGCGCTACGTGATGACCAGCAGGGACGTGCCGGTCAGCCAGCAGCGGCTGTTCG
TGGGGCGTGGGTTCTTGTGGGAGCAGAAGCATACCCATAGGCTCATGCAGACGTACCGGCCGGAGTTCCG
CCGCTACGCCGAGCCGACGCCGGCCTACCGCCTGGCCAGGCGCCTGGAGGAACGGCTGGAATTCGCGCCA
TTGCCGCTCTCGCGCCTGCCGAAGCTCACCGGCTGGGACGTGCCTTTCAACCCCGTGCGCCCGTTGCCGC
CTGTCGGTGGCCTGCCGCGCCTGCACGGCATCGAACCCGACGAGGTGGATGTCAGCCTGCCGCTGGGCGA
GCGCGTCGGCCACTCGCTGGTGCTGGGCACCACGCGGGTGGGCAAAACGCGCCTGGCCGAGTTGTTCGTC
ACGCAGGACATCCGCCGCAGGAATGCTGCCGGCGAGCATGAGGTCGTCATCGTCATCGATCCCAAGGGGG
ATGCCGATCTCTTGAAGCGGATGTACGTCGAAGCCCAGCGCGCTGGCCGCGAAGGCGAGTTCTACGTCTT
CCACTTGGGCTGGCCGGACATTTCGGCACGCTACAACGCGGTGGGCCGCTTCGGCCGCATCAGCGAAGTG
GCGACCCGGGTGGCGGGGCAGCTCTCCGGCGAAGGCAACAGCGCGGCGTTCCGCGAGTTCGCATGGCGCT
TCGTGAACATCATCGCCCGCGCCCTGGTGGAACTGGGGCAGCGCCCGGACTACATGCTGATCCAGCGCCA
CGTCATCAACATCGACGCGCTGTTCATCGAGTACGCCCAGCACTACTTCGCCAAGACGGAGCCCAAGGCC
TGGGAGGTGATCGTCCAGATCGAGGCCAAGCTCAACGAGAAGAACATCCCGCGCAACATGATCGGGCGCG
AGAAGCGCGTGGTGGCGCTGGAGCAGTACCTCTCGCAGGCGCGCAACTACGACCCGGTGCTGGATGGCCT
GCGCTCGGCGGTTCGCTACGACAAGACCTACTTCGACAAGATCGTTGCATCGCTTCTGCCGCTGCTGGAA
AAGCTCACCAGCGGCAAGATCGCCCAGCTCCTGGCGCCGAACTACTCCGACCTGGCCGACCCACGGCCGA
TCTTCGACTGGATGCAGGTGATCAGGAAGCGAGCCGTCGTCTATGTGGGCCTGGATGCGCTGTCCGATGC
CGAGGTCGCCGCGGCGGTCGGCAATTCGATGTTCTCCGACCTGGTTTCGGTCGCAGGCCACATCTACAAG
CACGGGATCGACGATGGACTGCCGGGTGCATCGGCTGGTGCGCGCGTGCCGATCAACGTGCATGCGGACG
AGTTCAATGAATTGATGGGTGACGAGTTCATTCCGCTCATCAACAAGGGCGGTGGCGCGGGCCTGCAAGT
CACCGCCTACACGCAAACGCTCTCGGACATCGAGGCCCGCATCGGCAATCGCGCGAAGGCCGGCCAAGTG
ATCGGGAATTTCAACAACCTGTTCATGTTGCGCGTGCGCGAGACGGCCACCGCGGAACTGCTGACGAGGC
AGTTGCCGAAGGTCGAGGTCTATACGACTACCATCGTCTCGGGCGCGACGGACAGCTCAGACATCCGCGG
CGCGACGGATTTCACGTCGAACACCCAGGACCGCATCAGCATGTCCAGCGTGCCGATGATCGAGCCGTCA
CACGTCGTCGGCCTGCCCAAGGGCCAGTGCTTCGCGCTGCTGCAGGGCGGCCAGCTCTGGAAGGTGCGTA
TGCCGCTGCCGGCGCCGGACCCGGATGAAGTGATGCCGGCGGACCTGCAGCAACTGGCCGGGTACATGCG
CCAGAGCTACAGCGAGGCCACGCAGTGGTGGGAGTTCACCAGCTCGTCGGCCTTGCAGGATGCGGCCTTG
CCCGACGACCTGCTGGACGATGCCGCTGCGGCCGAGCCCGGCGCGGTGGCCACCGGCGCCGACGATGGCG
CGGGCAACGAGGCCGTGCCATGA
 Primer design