SecReT4
Protein ID: 121593679
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1275
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1351647..1352195 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDA1W5H4
KEGG IDajs:Ajs_1275, ajs:Ajs_1409
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 4.5e-51, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|121593679|ref|YP_985575.1| hypothetical protein Ajs_1275 [Acidovorax sp. JS42]
MTKPHPAHLAFTGLLMLLSGLPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPARPPIPTPRVPA
TPADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVIGDDEASRAWLQRRAAALRERGVVGLVVNVETAQ
GLARLRALVPGVPLAPVAGDDLAERLGLQHYPALITATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1352195-1351647 Acidovorax sp. JS42 chromosome, complete genome
ATGACGAAACCCCATCCCGCCCATCTCGCGTTCACGGGCCTGCTCATGCTGCTGTCAGGCCTGCCGCTGG
CCTCGCGTGCCGGCGAGCCACTGATCGTTGTCGAGGACCGCGGCGGCACGTCGGCGCTGCCGTACTACGA
AGCCCTGAACCTGCAGCCGCGCGCCAACGCACCGGCGCGGCCGCCCATCCCGACGCCCCGGGTTCCCGCC
ACGCCAGCGGACGAAGCCGCGATGCTGCCGGTGCGCAGCGCCAAGCTCACGCCCGGCACCGTCGCGCGAC
GGGTGATTGAAGCGCCCGGCCTGCGGCCGTTCGTGGTCATCGGCGACGACGAGGCTTCCCGGGCCTGGTT
GCAGCGCCGCGCCGCCGCTTTGCGTGAACGCGGCGTGGTCGGCCTGGTGGTCAACGTCGAGACCGCGCAG
GGCCTGGCGCGGCTGCGCGCCCTGGTGCCTGGCGTACCGCTCGCGCCCGTGGCCGGCGACGACCTGGCCG
AGCGCCTGGGCCTGCAGCACTACCCGGCGCTGATCACGGCCACCGGCATCGAGCAATGA
 Primer design