SecReT4
Protein ID: 121593680
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1276
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1352192..1352782 [-]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDA1W5H5
KEGG IDajs:Ajs_1276, ajs:Ajs_1410
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|121593680|ref|YP_985576.1| lytic transglycosylase catalytic subunit [Acidovorax sp. JS42]
MAAPAVAMPLRALVLTAGLYAVAALAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRTVPWPWS
LNVAGQSRRFATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQRRYANACDLLDPYRNLATAAEILKE
QHAPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGARPAAAALAARQETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1352782-1352192 Acidovorax sp. JS42 chromosome, complete genome
ATGGCAGCGCCAGCCGTAGCCATGCCCCTGCGCGCACTGGTGCTCACTGCCGGCCTGTATGCCGTTGCCG
CCCTGGCCCAGGAGGTTCCGCCACCGGCCTACCAGCTTGCCGCCCAGCGAGCAGGCATCCCTTCGACGGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGCCGCAACGGTCGCACCGTCCCGTGGCCGTGGTCC
CTCAACGTCGCCGGCCAGTCGCGCCGCTTTGCCACGCGCGCCGATGCCTGCGCAGGTCTCCAGCAGGCGA
TGCGCTCCACGCCGCACACGCGCATCGACGCGGGCCTGGGCCAGATCAACCTCGGCTATCACCAGCGGCG
CTACGCCAATGCGTGCGACTTGCTCGACCCGTACCGCAACCTCGCCACCGCTGCCGAGATCCTGAAGGAA
CAGCACGCCCCCGGCGAGGACTGGTTGCTGGCGATCGGCCGCTACCACCGCCCCGCGGGCGGTGAACCCG
CTGCCCGCTATCGCCGTAGCGTGTCCCGCCACCTTGCCCGTGTGCAGGGCGCGCGCCCAGCCGCCGCGGC
CCTCGCCGCGCGCCAGGAGACCTCCCCATGA
 Primer design