SecReT4
Protein ID: 121593681
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1277
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1352764..1353489 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDA1W5H6
KEGG IDajs:Ajs_1277
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|121593681|ref|YP_985577.1| hypothetical protein Ajs_1277 [Acidovorax sp. JS42]
MKPSILLTLFLLAAAQLPVWAQQPATAQSRNAQSQERPVIGRILDDRVASDWGLQPQEWARYRELMEGPL
GIYSPNLDPLSALGVEARSDEERRRYAEMQVKAEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDLPT
AAGVRGSSRTAVFVKDGCAACGQLVQRLQSSGAEFDLYMVGSRQDDARIRDWAKRANVDPARVRAGSITL
NHDGGRWLSLGLPGDLPAAVREVNGQWQRQP
 
Nucleotide Sequence: 726 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1353489-1352764 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGCCCTCGATCTTGCTCACCCTGTTCCTGCTGGCCGCAGCGCAGTTGCCCGTCTGGGCGCAGCAGC
CCGCCACGGCCCAGTCCCGCAATGCCCAGAGCCAGGAGCGTCCCGTGATCGGCCGCATCCTGGACGACCG
CGTGGCGAGCGACTGGGGACTGCAACCGCAGGAGTGGGCGCGCTACCGCGAACTGATGGAGGGGCCGCTG
GGCATCTACTCGCCCAACCTGGACCCGCTTTCCGCGCTGGGCGTCGAGGCTCGCTCCGATGAAGAGCGGC
GCCGCTACGCCGAAATGCAGGTGAAAGCCGAGGCAAGGCGCGTCGAGAAGTTGCTTGCCTACCAGCGCGC
CTACGACGAAGCGTGGCAGCGCCTGAACCCCGGCATGCAGCGAGTGAACCTCCCCGATGATCTGCCGACC
GCCGCAGGCGTGCGCGGCAGTAGCCGCACGGCGGTGTTCGTGAAGGACGGCTGCGCGGCCTGCGGGCAAC
TCGTGCAGCGCCTGCAATCCTCGGGCGCCGAGTTCGACCTCTACATGGTCGGCAGCCGCCAGGACGATGC
GCGCATCCGCGACTGGGCCAAGCGCGCGAACGTCGATCCGGCGCGCGTGCGCGCCGGCAGCATCACGCTC
AACCACGACGGCGGCCGCTGGCTGTCGCTGGGCCTGCCCGGCGATCTGCCCGCCGCCGTGCGCGAAGTGA
ATGGCCAATGGCAGCGCCAGCCGTAG
 Primer design