SecReT4
Protein ID: 121593683
T4SS name [ID]Tfc [728]
Gene symbol-
Locus tagAjs_1279
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1354138..1354704 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDA1W5H8
KEGG IDajs:Ajs_1279
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 188 a.a.     [Download]
>gi|121593683|ref|YP_985579.1| hypothetical protein Ajs_1279 [Acidovorax sp. JS42]
MPAIHVSRHLVGAGLLAAALASGCATTTAPLAPDAIEEVSAAPEPEAPEYIPVVRYGRYTLVELAPTAAQ
RDLLLQTIDVSMPEDARATVGDGLRHVLKRSGYGLCETAHAVIELYALPLPAAHLHLGPMTLRDALLTLA
GPAWDLHADDRTRQVCFERHGRDADADPVPEPLATEAVQTFPLAGGQP
 
Nucleotide Sequence: 567 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1354704-1354138 Acidovorax sp. JS42 chromosome, complete genome
ATGCCCGCAATCCATGTATCCCGGCACCTGGTCGGCGCCGGCCTCCTGGCCGCAGCCTTGGCCAGCGGCT
GCGCGACCACCACGGCGCCGCTCGCACCCGATGCCATCGAGGAAGTCTCGGCCGCGCCCGAACCCGAGGC
GCCCGAGTACATCCCGGTCGTGCGCTACGGCCGCTACACCCTGGTCGAGTTGGCACCCACGGCGGCGCAG
CGCGACCTGCTGTTGCAGACCATCGACGTGTCCATGCCCGAGGATGCCCGCGCCACGGTTGGCGACGGGC
TGCGGCATGTGCTCAAGCGCAGCGGCTATGGCCTTTGCGAGACCGCGCATGCCGTGATCGAGCTGTACGC
GCTGCCGTTGCCTGCGGCACATCTGCACCTCGGCCCTATGACCTTGCGCGATGCGCTACTCACCCTTGCC
GGCCCGGCCTGGGACCTGCACGCCGATGACCGGACGCGACAGGTCTGCTTCGAGCGGCACGGCCGCGATG
CAGATGCCGATCCGGTTCCCGAACCACTCGCCACCGAGGCGGTGCAGACGTTCCCGCTCGCGGGAGGTCA
GCCATGA
 Primer design