SecReT4
Protein ID: 121593788
T4SS name [ID]Tfc [729]
Gene symbol-
Locus tagAjs_1393
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1460289..1461686 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1W5T3
KEGG IDajs:Ajs_1393
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|121593788|ref|YP_985684.1| hypothetical protein Ajs_1393 [Acidovorax sp. JS42]
MKIRTALNPLSRQARHTKIVLALAGTLALASGVAWGQLGYQTSGSVIGDDVMYSIGGGSAVSMGRAAGMR
SLGVGVGWNSNLICGDMSIQTTLKNQLNGITNGFQQIMSSVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQMAEGLALRDAVSSTDAVSAIEQAETRRGNDGVPWI
GGSNAGGSGQPAIKVVGDVTRAGYNLVNGRGVTDTSSIAPSSCSSLSCQTWASPQAAVEWATRVLGEKEQ
RTCDACTKTETTPGVGLTPLIQEEYDAKLQALQGLVSKAKNTTPENLREAGSASLPITRGVIEALRDEPD
QHLLSQRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVDAVNKESDTLDREIRNLKTELELRRE
LANNSPMAIIQRHGARATGSRGIYEGDPVPDRLDQLQKGNPGSQP
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1461686-1460289 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGATTCGTACCGCACTCAATCCGCTCTCCCGCCAGGCACGCCACACGAAGATCGTCCTGGCGCTGG
CCGGCACGCTCGCGCTGGCCAGCGGCGTGGCCTGGGGCCAACTGGGCTACCAGACCAGCGGCAGCGTCAT
CGGCGATGACGTCATGTACTCGATCGGCGGCGGCAGTGCCGTGTCGATGGGACGCGCGGCCGGCATGCGC
TCCCTCGGGGTGGGCGTGGGCTGGAACAGCAACTTGATCTGCGGCGACATGAGCATCCAGACCACGTTGA
AGAACCAGCTCAACGGCATCACCAACGGCTTCCAGCAAATCATGTCGTCAGTGATCCAGAGCGCCACCAG
CGCGGTGGCGTCTTTGCCTGCGCTGATCATCCAGCGCGCCGATCCCGGCCTCTACAACCTGCTTACCAAT
GGCGTGCTGCAGGCACGTCTCGATTTCGACCGCTCCAAGCTGACGTGCCGTGCCATGGCCGAGAAGATGG
CCGACACGGCAGGCGGCCAGCTCGGCTGGAGCCAGATGGCCGAAGGCTTGGCGCTGCGCGATGCTGTGTC
GAGTACGGATGCGGTCTCGGCCATCGAGCAGGCCGAGACGCGCCGCGGCAATGACGGCGTGCCGTGGATC
GGGGGCAGCAACGCGGGCGGCTCCGGTCAGCCCGCAATCAAGGTCGTCGGCGATGTCACCCGCGCCGGCT
ACAACCTGGTCAACGGCCGCGGCGTGACCGATACGTCGTCCATCGCGCCGTCCAGTTGCAGCAGCCTCTC
GTGCCAGACCTGGGCCTCGCCGCAGGCGGCCGTCGAGTGGGCCACGCGCGTGCTCGGCGAGAAGGAACAA
CGCACTTGCGATGCCTGCACAAAGACCGAGACGACGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAAG
AGTACGACGCGAAGCTGCAGGCGCTCCAGGGTCTCGTCTCCAAGGCGAAGAACACGACGCCGGAGAACCT
GCGCGAGGCCGGCAGTGCATCGCTGCCGATCACGCGCGGCGTGATCGAAGCACTGCGCGACGAGCCCGAC
CAGCATCTGCTGTCGCAGCGCCTGGCGTCCGAGGTCGCGCTGTCGTCCGTGCTGGAGAAAGCGCTGCTGC
TGCAGCGCACGCTGCTCACGGGGAAGAAGGAGCCCAACGTCGCGGCCAACGAGCTTGCGGTGGATGCCGT
AAACAAGGAGAGCGACACACTCGACCGCGAAATCCGCAACCTCAAGACGGAACTGGAGCTGCGGCGCGAG
CTGGCGAACAATTCGCCCATGGCGATCATCCAGCGCCACGGCGCGCGCGCGACTGGCTCGCGCGGCATCT
ACGAGGGCGACCCGGTGCCTGATCGTCTCGACCAGCTCCAGAAGGGCAATCCGGGGAGTCAGCCATGA
 Primer design