SecReT4
Protein ID: 121593801
T4SS name [ID]Tfc [729]
Gene symbol-
Locus tagAjs_1406
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1472041..1472421 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA1W5U6
KEGG IDajs:Ajs_1406
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.3e-30, Aligned region: 28..108
Protein Sequence: 126 a.a.     [Download]
>gi|121593801|ref|YP_985697.1| hypothetical protein Ajs_1406 [Acidovorax sp. JS42]
MLAPIWQRAAHRGVPIFLVTALLGQSPMALAESPAQRQELVAALRQLGALERSVADSAAHAPVQPGERYH
FDYPRLLADLARVRAGIQAHLAPSRAQPRDPSELAGDYRAERAASPSPTATAEGKP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1472421-1472041 Acidovorax sp. JS42 chromosome, complete genome
ATGTTGGCTCCGATCTGGCAGCGTGCCGCGCATCGCGGCGTGCCCATCTTTCTCGTGACGGCCCTGCTGG
GTCAGTCCCCGATGGCGTTGGCCGAATCCCCCGCACAGCGCCAGGAGCTGGTCGCCGCGCTGCGCCAGCT
CGGCGCGCTGGAGCGCTCCGTCGCCGACAGCGCCGCGCATGCCCCCGTCCAGCCGGGCGAGCGCTACCAC
TTCGACTACCCGCGGCTGCTGGCTGACCTGGCGCGCGTGCGCGCCGGCATCCAGGCCCATCTCGCACCGT
CGCGTGCCCAGCCGCGCGATCCCTCCGAACTGGCCGGCGACTACCGCGCCGAGCGGGCCGCTTCGCCATC
GCCGACGGCGACTGCGGAAGGCAAGCCATGA
 Primer design