SecReT4
Protein ID: 121593802
T4SS name [ID]Tfc [729]
Gene symbol-
Locus tagAjs_1407
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1472520..1473269 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1W5U7
KEGG IDajs:Ajs_1407
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.9e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|121593802|ref|YP_985698.1| hypothetical protein Ajs_1407 [Acidovorax sp. JS42]
MKDAASTAQREQNKRQGLIVGTITLPFRLLGVLIGSLLFSIAVECVGMHLFWKDQGWRHSQQMLQYELGH
LSDHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAGRARAPSQGQTHNFRYYISQVYVWTES
YLIAAAFTTLTFLVRLLILVLTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WVTYLALPISVHPLLILLPSAALLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1473269-1472520 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACAAACGCCAAGGCTTGATCGTCGGCACCATCA
CCTTACCGTTCCGGCTGCTCGGGGTGCTCATTGGCTCGCTGCTGTTCTCGATCGCGGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGCCACTCCCAGCAGATGCTGCAGTACGAACTCGGGCAC
CTGTCCGACCACTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGCACGGCGCACGAGCTGGTGGACA
CCGGCTACGAATGGGTATTCGTGCGCTCCGGTCTGCTGGAACGCATGAGCCAGACCGCCGGACGCGCCCG
CGCTCCCAGCCAGGGACAGACGCACAATTTCCGCTACTACATCAGCCAGGTTTATGTCTGGACCGAGAGC
TACCTGATCGCCGCTGCTTTCACGACGCTCACGTTCCTGGTGCGCCTTCTGATCCTGGTGCTCACGCTGC
CGCTGATCTTCACCGCCGCGTTCGTTGGCCTGATCGACGGCCTGGTGCGCCGGGACGTGCGCCGGTTCGG
CGCAGGCCGGGAATCCGGCTTCATCTACCACCGCGCGAAGGCGAGCCTGATGCCGCTGGCCGTGCTGCCG
TGGGTCACGTACCTCGCGCTGCCGATCTCGGTGCATCCGCTGCTGATCCTGCTGCCGAGCGCCGCCTTGC
TGGGGCTGGCGGTCTCCCTGACCGCGGGGAGCTTCAAGAAGTACCTCTAG
 Primer design