SecReT4
Protein ID: 121593897
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1524
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1578073..1580844 [-]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDA1W642
KEGG IDajs:Ajs_1524
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1e-107, Aligned region: 3..468
Protein Sequence: 923 a.a.     [Download]
>gi|121593897|ref|YP_985793.1| TraG domain-containing protein [Acidovorax sp. JS42]
MWEIYAYQNADSLFGVFNAAAAIHASKDYASAIAAVAFCGFVAALIAYAFAPEKLQGWKWLGSVVLIFSI
LIVPKVTVGVVDKTGGSAVKVVDNVPFGVALLGSLTNTIGHTLTGLFETAFQVIPGAGALPAELSYQQNG
LMFGNRLVRETGNVVFQDPGFRTDLVNFIHNCTTYDLVDGTLDPAAFSASDDVWPLMGSPNPARFSTLTG
AGGAVGVDTCPNVYLSLNGRLPAQLRRIQGRLAFQLNPTLPGTAAAAAIAGQIQQAYLKNGIANASATTA
DIIRQNAMLNALEDTGKIVGQKVNDPAAMVLAVGRAQAVAQMNASWLNYGKVAEQALPVFRNVIEAVTYA
LFPLFVLLLLLTSGRETMLAFKGYAAILIWIQLWPPLYAILNYMASIYAAYDLAAAADLGTGGKALALQT
ASVIYSRALSGEAIVGYLAISIPFIAWAALKRMENFGTALVGGLSGLQAMLSGSTAASTVGNTSLGNVSM
DQMQLAPNRTSAFIGSWQNDLSGNTFTGNALTGRTAVSLLRNQGFASRVVSMRVSEQDVQDASRQVDAAR
SEAVAASSERSAVLAEAFTKGIAKLHSSRNSTGTTSSGFEQFGETVNRLDQISKSVADTTGFTQSQVARI
ALGATGHVGINTPLAGLGANASGDKSYLSGLSAAEQKVLTSMNSEQLAEFKQFGDRVSRDRSFISMVASD
SREAQDLSARLTSTTARTERADASLNERSAFAERVSTAHERGETISIDIAQDPHNLAMFTRYAEQYGGNS
ASARVLMEAELARQSLQPNRVFSDGTAVPTAFGDLSAQHLQNSGNPALAPEIGGQHRANQGSVRGSGGGP
RTGAPGESPSAMRSKVQAEGQRIRASSSEDQATFERKAQITKTPDGTLASERSLMKQSVNQVKEDAAPTI
EDAKQAIKDALKK
 
Nucleotide Sequence: 2772 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1580844-1578073 Acidovorax sp. JS42 chromosome, complete genome
ATGTGGGAGATCTACGCTTACCAGAACGCCGACAGCCTGTTCGGCGTATTCAACGCGGCTGCGGCCATCC
ATGCCTCCAAGGACTATGCCTCCGCCATAGCGGCCGTCGCCTTCTGCGGCTTCGTCGCGGCGCTGATCGC
CTACGCTTTCGCGCCGGAGAAACTCCAAGGCTGGAAGTGGCTGGGCTCAGTGGTGCTGATTTTCAGCATC
CTGATCGTGCCCAAAGTGACCGTGGGCGTGGTCGACAAGACCGGCGGCTCCGCGGTCAAGGTCGTGGACA
ACGTGCCGTTCGGCGTGGCGCTGCTGGGCAGCCTCACCAACACCATCGGCCATACGCTGACTGGCCTGTT
CGAGACGGCCTTCCAGGTGATCCCGGGCGCCGGCGCGCTGCCGGCCGAGCTGTCCTACCAGCAGAACGGC
CTGATGTTCGGCAACAGGCTGGTCCGCGAGACCGGCAATGTCGTCTTCCAGGATCCGGGGTTCAGGACCG
ACCTGGTCAACTTCATCCACAACTGCACGACGTATGACCTGGTCGACGGCACGCTGGATCCGGCGGCGTT
TTCTGCGTCGGACGATGTCTGGCCGCTGATGGGCTCGCCCAATCCGGCCCGGTTCAGTACCTTGACAGGT
GCCGGTGGAGCAGTCGGCGTGGACACCTGCCCCAACGTGTACCTGAGCCTGAACGGCCGGTTGCCGGCGC
AATTGCGGCGCATCCAGGGGCGGCTGGCCTTCCAGCTCAACCCGACACTGCCGGGCACGGCCGCCGCGGC
GGCCATCGCAGGCCAGATCCAGCAGGCTTACCTGAAGAACGGCATCGCCAACGCTTCGGCGACCACTGCG
GACATCATCCGCCAGAACGCCATGCTGAATGCGCTGGAGGATACGGGCAAGATCGTGGGACAGAAAGTCA
ATGACCCGGCCGCCATGGTGCTCGCCGTGGGCCGGGCACAAGCCGTGGCCCAGATGAATGCCTCGTGGCT
GAACTACGGCAAGGTGGCTGAGCAGGCGCTGCCGGTGTTCCGCAACGTGATCGAGGCGGTGACATACGCC
CTCTTCCCGCTGTTCGTGCTCTTGCTGCTGCTGACGAGTGGCCGCGAGACCATGCTGGCCTTCAAGGGCT
ATGCCGCCATCCTGATCTGGATCCAGCTGTGGCCTCCGCTCTATGCGATCCTGAACTACATGGCCTCGAT
CTACGCCGCCTACGACCTGGCGGCCGCCGCTGATCTCGGCACCGGCGGCAAGGCCCTGGCCCTGCAGACC
GCCTCGGTGATCTACTCCCGGGCGCTGTCAGGCGAGGCCATCGTCGGGTATCTCGCCATCAGCATCCCGT
TTATCGCCTGGGCCGCGCTCAAGCGCATGGAGAATTTCGGTACAGCCCTGGTGGGCGGGTTGTCGGGGCT
GCAAGCCATGCTGTCCGGATCGACCGCGGCGTCCACCGTGGGCAATACCTCGCTGGGCAATGTCTCCATG
GACCAGATGCAGCTCGCGCCCAACCGGACCTCGGCCTTCATAGGCAGTTGGCAGAACGACCTAAGCGGCA
ACACCTTCACCGGCAATGCCCTGACCGGTCGCACGGCAGTGAGCCTGCTGCGCAACCAGGGCTTTGCGTC
ACGGGTGGTGTCGATGCGGGTGTCCGAGCAGGATGTGCAGGACGCGAGTCGGCAGGTGGATGCCGCGCGC
AGCGAGGCGGTGGCAGCCAGCAGCGAGCGCTCGGCGGTGCTCGCCGAAGCGTTCACCAAGGGCATCGCCA
AGCTGCACTCGTCGCGCAACAGCACCGGCACCACGTCGAGTGGCTTCGAGCAGTTCGGGGAGACCGTCAA
CAGGCTGGACCAGATCAGCAAGAGCGTGGCGGACACTACAGGGTTCACGCAATCTCAGGTCGCACGAATT
GCCTTGGGTGCCACGGGCCACGTGGGCATCAATACACCCCTTGCTGGGCTAGGAGCAAACGCATCCGGTG
ACAAGAGCTATTTGTCCGGCCTCTCCGCTGCCGAGCAAAAGGTATTGACCTCCATGAACAGCGAGCAACT
GGCCGAGTTCAAGCAGTTTGGCGACCGGGTGTCTCGGGACAGAAGCTTCATCAGCATGGTCGCCAGTGAC
AGCCGCGAAGCTCAGGATCTGTCTGCCCGGCTGACATCGACCACCGCGCGGACCGAGCGGGCCGATGCCA
GCTTGAACGAGCGGAGCGCCTTTGCCGAGCGCGTCTCGACGGCCCACGAACGCGGCGAGACCATCTCGAT
CGATATCGCCCAGGACCCGCACAATCTCGCAATGTTTACCCGCTACGCCGAGCAGTATGGTGGCAACAGC
GCGTCGGCGCGCGTGCTGATGGAAGCGGAGCTGGCCAGGCAGTCGCTACAGCCGAACCGCGTGTTCTCAG
ACGGGACCGCAGTACCGACTGCCTTTGGAGACCTGTCCGCCCAGCACTTGCAGAATTCCGGCAATCCTGC
CCTTGCGCCGGAAATTGGAGGCCAGCACCGCGCCAACCAAGGCAGCGTGCGCGGCTCCGGCGGTGGGCCC
AGGACTGGGGCTCCGGGTGAGTCCCCGTCAGCCATGCGCAGCAAGGTCCAGGCAGAAGGCCAGCGTATCC
GTGCAAGCTCCTCCGAGGACCAGGCCACTTTTGAGCGCAAGGCGCAGATCACCAAAACACCGGATGGAAC
GTTGGCATCTGAGCGTTCCTTGATGAAGCAATCCGTCAATCAGGTCAAGGAAGACGCCGCGCCCACCATC
GAAGACGCCAAGCAGGCTATCAAGGATGCGCTGAAGAAATAG
 Primer design