SecReT4
Protein ID: 121593898
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1525
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1580866..1582314 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDA1W643
KEGG IDajs:Ajs_1525
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.6e-96, Aligned region: 37..396
Protein Sequence: 482 a.a.     [Download]
>gi|121593898|ref|YP_985794.1| TraH family protein [Acidovorax sp. JS42]
MPIHSRTVHARKATAAAVALSLLCTTMPSRADLNSEVNDMFNNLGAIGNYTAPGAFRGQTYNTYTGGSLM
MRSPNKVYQLAAIQFPSAKAGCGGIDVFGGSFSHISAQEFKNMLRNITAALPGIAFQLALEAVSPLLGGL
TKWAKGLETWINNARINSCETAKAIVSTAAEAVGYSAQETCADLAIDMGLESDRDAARKRCGTDRPSILS
SARSSGDANVRNKAPFVGNLTWKALQYTGAYLDDAERELIMSMVGTIIYYPEESKRDPEPIAPTLTSISQ
LLYGQAAGSGTDVVQHLRRCNDYTNCDVVSLNTNYSHVPFTAKVETMMRSISDKIATRTPIPNNSAEVGF
VNQTTEPVYKMLSVGTSIPGSGLADSLIGQYRDVIAADYAYVFLERNLRLGMAALSKDYTLQQTQRDQAN
QVRQRAQAMLLQISQEKNLLYQKVGSFRAVASHLEELERQLRTSMPQHVMDMLGQQAAYLSR
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1582314-1580866 Acidovorax sp. JS42 chromosome, complete genome
ATGCCCATCCATTCCCGCACCGTTCATGCGCGCAAGGCCACTGCTGCGGCCGTCGCCCTGTCGCTTCTGT
GCACCACGATGCCCAGTCGCGCTGATCTCAACAGCGAGGTCAACGACATGTTCAATAACCTGGGCGCCAT
CGGCAACTACACGGCGCCCGGGGCGTTCCGGGGCCAGACCTACAACACCTACACCGGCGGCTCACTCATG
ATGCGCTCGCCGAACAAGGTGTATCAATTGGCGGCCATCCAGTTTCCGAGCGCGAAAGCAGGCTGCGGCG
GGATCGACGTGTTCGGTGGCAGCTTCAGCCACATCTCCGCGCAGGAGTTCAAGAACATGCTGCGCAACAT
CACGGCGGCCCTGCCGGGCATCGCTTTCCAACTGGCGCTGGAAGCGGTCTCCCCCCTGCTCGGTGGACTC
ACCAAATGGGCCAAGGGCCTGGAGACATGGATCAACAACGCCCGCATCAATTCCTGCGAAACGGCGAAAG
CCATCGTCAGTACGGCAGCCGAAGCCGTGGGCTACAGCGCGCAGGAGACCTGCGCCGATCTCGCGATCGA
CATGGGTCTGGAGAGCGACCGGGACGCGGCGCGCAAACGCTGTGGCACCGACCGGCCCAGCATCCTGTCG
TCGGCGCGGTCGTCGGGAGATGCCAATGTGCGCAACAAGGCCCCTTTCGTCGGCAACCTGACCTGGAAAG
CTCTGCAGTACACCGGCGCCTATCTAGATGATGCCGAACGCGAGCTGATTATGAGCATGGTCGGTACCAT
CATCTACTACCCCGAGGAATCGAAGCGCGATCCGGAACCCATCGCGCCGACGCTCACCTCCATCAGCCAA
CTGCTCTACGGCCAGGCTGCGGGCTCCGGCACCGACGTCGTCCAGCACCTGCGGCGCTGCAACGACTACA
CGAACTGCGATGTGGTCTCGCTCAATACCAACTACAGCCACGTCCCATTCACGGCGAAGGTCGAAACGAT
GATGCGCTCGATCTCTGACAAGATTGCCACGCGCACGCCGATTCCCAACAACTCGGCGGAAGTGGGCTTC
GTGAACCAGACCACCGAACCCGTCTACAAGATGCTCTCGGTGGGCACCAGCATCCCGGGTTCGGGCCTGG
CCGACAGCCTGATCGGCCAGTACCGCGACGTGATCGCCGCGGACTATGCCTACGTCTTCCTCGAACGCAA
TCTGCGCCTGGGCATGGCAGCTCTGTCCAAGGACTACACCTTGCAGCAGACCCAGCGCGACCAGGCCAAC
CAGGTGCGCCAGCGTGCGCAGGCCATGCTGTTGCAGATCTCGCAGGAGAAGAACCTGCTGTACCAGAAGG
TCGGCTCGTTCCGGGCCGTGGCAAGCCACCTGGAAGAGCTCGAGCGGCAATTGCGCACCAGCATGCCCCA
GCACGTCATGGACATGCTGGGCCAGCAGGCGGCCTACCTGTCGCGCTGA
 Primer design