SecReT4
Protein ID: 121593899
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1526
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1582324..1583199 [-]
Producthypothetical protein
Component typeTraF_F
UniProt IDA1W644
KEGG IDajs:Ajs_1526
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.9e-72, Aligned region: 49..269
Thioredoxin_2 [PF13098], Evalue: 4.9e-06, Aligned region: 176..268
Thioredoxin_8 [PF13905], Evalue: 6.8e-06, Aligned region: 177..215
AhpC-TSA [PF00578], Evalue: 3.5e-05, Aligned region: 158..214
Redoxin [PF08534], Evalue: 8.1e-05, Aligned region: 164..214
Protein Sequence: 291 a.a.     [Download]
>gi|121593899|ref|YP_985795.1| hypothetical protein Ajs_1526 [Acidovorax sp. JS42]
MCARLPLILATAVVSAAAMVVGMAAAQGVAPPASMDDASRPYWSDGWRGWHFYEDPPLEKPAPTARPAPA
IPPRPSAPPRPPELVEFERLQKTLEELRNIAIMRPTERNVRRYMELEMQVVNRASYFADMAQRVAWATPE
LDPTLQGRPVNAQALEVFDQQQRAGRSTSVESLGRDHVLFFFYRSDCPYCHAFAPTLQAFEARHGIQVVA
VSVDGGPMPGFPRARPDNGIATALKVTQVPAVFLAQPYSGKITPIGFGVLSESQLLERIATVSSPTGEAM
LPGATQRLALP
 
Nucleotide Sequence: 876 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1583199-1582324 Acidovorax sp. JS42 chromosome, complete genome
ATGTGCGCGCGTCTCCCTTTGATCCTGGCTACTGCCGTGGTCTCTGCGGCCGCTATGGTGGTCGGCATGG
CCGCTGCGCAGGGCGTTGCTCCGCCGGCGTCCATGGACGACGCCTCGCGCCCCTACTGGTCCGACGGCTG
GCGCGGTTGGCACTTCTACGAGGATCCACCCCTGGAAAAGCCCGCGCCCACCGCCCGGCCCGCGCCGGCC
ATCCCGCCCCGGCCCTCCGCCCCACCACGCCCGCCTGAGCTGGTGGAGTTCGAGCGCCTGCAGAAGACCC
TTGAGGAATTGCGCAACATCGCGATCATGCGGCCGACCGAGCGCAACGTGCGGCGCTACATGGAGCTGGA
GATGCAGGTGGTGAACCGGGCCTCCTACTTCGCGGATATGGCGCAGCGCGTGGCCTGGGCCACGCCCGAG
CTCGACCCGACCCTGCAAGGTCGTCCGGTCAATGCCCAGGCGTTGGAGGTCTTCGATCAGCAGCAGCGCG
CAGGCCGTTCCACCTCCGTTGAATCGCTGGGCCGCGACCATGTGCTGTTCTTCTTCTACCGCAGCGACTG
CCCCTACTGCCACGCGTTCGCGCCAACCCTGCAGGCTTTCGAAGCCCGTCATGGCATTCAGGTGGTGGCT
GTCAGCGTGGACGGCGGCCCGATGCCGGGATTCCCTCGGGCCCGGCCCGACAACGGCATTGCCACGGCCT
TGAAGGTGACCCAGGTGCCGGCCGTTTTCCTGGCCCAGCCGTACAGCGGAAAGATCACCCCGATCGGCTT
CGGCGTGCTGTCCGAATCTCAACTGCTCGAGCGGATCGCCACCGTCTCATCGCCCACCGGCGAGGCCATG
CTGCCCGGCGCCACCCAGCGCCTGGCTCTTCCGTAG
 Primer design