SecReT4
Protein ID: 121593901
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1528
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1583596..1586013 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA1W646
KEGG IDajs:Ajs_1528
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 6.1e-42, Aligned region: 419..583
TraN [PF06986], Evalue: 6.1e-42, Aligned region: 672..755
Protein Sequence: 805 a.a.     [Download]
>gi|121593901|ref|YP_985797.1| conjugal transfer mating pair stabilization protein TraN [Acidovorax sp. JS42]
MPAALALLLRRIVVGITLVSFLATQTAAVAGPHEEGTAAGQAANPVVRGTITTPSASSVVPGYTAAPPER
LYYGQPNLSGQTSAQFAACALTPNDPVCQALLGARASANTPREPVSPYDPAVLGARRIAANPSTQLEDIA
SYYSGCQVDTVVTPATETRVCRQYSDATAQSCARTLSVSISRTSSCSPGEWFAQAASGSIALAVQCKPDL
PASAQHFRVTSNGVPLAFFDVDMSAAYVFPQMVAQVPGGNWWGGGANGVWVANNRCNGDDCRLTGFIAQQ
YRQICTGSGGDSGDMTCTTERPFLEVYAACPAGTQSGDHIAYTTGGGGDSGSSQTTYLDKATCYAPTQGP
SDYPGYDDTGAVSGSYWTVQSSRPVVGFQLNPAYGPIPQMTLAYERPHTTVTESDQWDDQCPNLQGDGRC
SISGAARCVDGPATRQIDGAPVTRACWRYETAMSCQYGAPTDECAPLAAAGCTPAGTSCKQTNPATGACE
VTENRYTCPVAPASTVAASNCPANVFCIAGNCFNTAYTNDADFARSMSFLEAGREAGVYLDTDNLQVFKG
EANSCRDRLLKNCCYADSAGSGMSNQSVYGVGSRLVYDTLMNAGNREFVYQGLSALLTGGGFSGSFTSYG
VTVAVNGTALPAGSAVLYSGESVIIAFDPWSLVIAVVIYIVMSMMSCNEDEGKLAMKEGAKLCHTVGTYC
SSCLRILGKCVSCIEHTTTKCCFNSVLARIINEQGRLQVMKWWGTAEMPDCSGFTIAQLQALDFSRMDLT
EFYASIVPKLPNVGAIQGGNSGRASNCYYGEGRCQ
 
Nucleotide Sequence: 2418 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1586013-1583596 Acidovorax sp. JS42 chromosome, complete genome
ATGCCTGCCGCCCTTGCACTGCTGCTGCGCCGGATCGTCGTCGGCATCACGCTGGTCAGCTTCCTCGCGA
CGCAAACGGCGGCCGTGGCCGGCCCCCACGAGGAAGGCACGGCCGCCGGACAGGCAGCCAACCCGGTGGT
CCGGGGAACGATTACAACGCCCAGCGCTTCGTCCGTGGTGCCGGGCTACACGGCGGCTCCACCCGAGCGC
CTCTACTACGGCCAGCCCAATCTCTCGGGCCAGACCAGCGCGCAGTTCGCCGCCTGCGCCCTGACACCCA
ACGACCCGGTGTGCCAGGCGCTGCTGGGCGCCCGGGCTTCGGCCAACACGCCGCGGGAGCCGGTCTCGCC
CTACGACCCTGCCGTGCTGGGCGCCCGGCGCATCGCGGCCAATCCCTCGACGCAGTTGGAGGACATCGCG
AGCTACTACAGCGGCTGCCAGGTCGATACCGTGGTCACGCCGGCGACGGAGACCCGCGTATGCCGGCAGT
ACAGCGACGCCACGGCGCAATCCTGCGCGCGCACCCTGTCGGTGTCGATCTCGCGCACGAGCAGTTGCTC
GCCGGGCGAGTGGTTCGCCCAGGCGGCCTCGGGAAGCATCGCGTTGGCCGTGCAGTGCAAACCGGATCTG
CCGGCCTCGGCCCAGCATTTCCGGGTCACGAGCAACGGCGTGCCGCTGGCCTTCTTCGATGTGGACATGA
GCGCCGCGTATGTGTTCCCGCAGATGGTCGCGCAGGTGCCAGGTGGCAATTGGTGGGGTGGCGGCGCCAA
CGGCGTCTGGGTCGCCAACAACCGCTGCAACGGCGACGACTGCCGCCTGACCGGCTTCATCGCCCAGCAG
TACCGGCAGATCTGCACCGGCAGCGGCGGGGACTCGGGTGATATGACCTGCACCACCGAGCGGCCCTTCC
TGGAGGTCTACGCCGCCTGCCCCGCCGGAACGCAAAGCGGCGACCACATCGCGTACACCACCGGTGGCGG
CGGCGACAGCGGATCCAGCCAGACGACCTACCTGGACAAGGCAACCTGCTACGCGCCGACGCAGGGGCCC
TCGGACTACCCCGGCTACGACGACACGGGCGCGGTCTCGGGCAGCTACTGGACGGTGCAATCGAGCCGCC
CCGTCGTTGGATTCCAGTTGAATCCGGCCTACGGCCCGATCCCGCAAATGACGCTGGCCTATGAGCGGCC
GCACACCACGGTCACGGAATCGGACCAGTGGGACGATCAATGTCCCAACCTCCAGGGCGACGGTCGTTGC
TCGATTTCCGGAGCGGCGCGCTGCGTGGACGGGCCGGCGACCCGGCAGATCGACGGCGCGCCGGTCACTC
GCGCCTGCTGGCGCTACGAGACCGCCATGTCGTGCCAGTACGGTGCACCCACCGACGAGTGCGCGCCGCT
GGCTGCCGCAGGCTGCACGCCAGCGGGCACCAGCTGCAAGCAAACCAACCCCGCCACCGGTGCGTGCGAG
GTCACCGAGAACCGCTACACCTGCCCGGTAGCGCCGGCCTCGACCGTGGCGGCCAGCAACTGCCCGGCCA
ACGTCTTCTGCATCGCGGGCAACTGCTTCAACACGGCCTACACGAACGATGCCGACTTCGCCCGCTCCAT
GTCCTTCCTGGAAGCCGGGCGCGAGGCCGGCGTCTACCTCGACACCGACAACCTACAGGTCTTCAAGGGA
GAGGCGAACAGCTGCCGCGACCGCCTGCTCAAGAACTGCTGCTACGCCGACTCGGCCGGCTCGGGCATGA
GCAACCAGAGCGTCTACGGCGTCGGCTCACGGCTGGTCTACGACACGCTCATGAACGCCGGCAACCGCGA
GTTCGTCTACCAGGGACTGTCGGCTCTGCTGACCGGCGGGGGATTCTCCGGCAGCTTCACCAGCTACGGC
GTCACCGTGGCCGTCAACGGTACGGCCCTGCCGGCGGGGTCAGCCGTCCTCTACTCCGGCGAGAGCGTGA
TCATTGCCTTCGACCCGTGGAGCCTGGTGATAGCAGTCGTCATCTACATCGTGATGTCGATGATGTCCTG
CAACGAGGATGAGGGAAAGCTCGCCATGAAGGAAGGCGCAAAGCTGTGCCACACCGTCGGCACCTACTGC
TCTTCCTGCCTGCGGATCCTGGGCAAGTGCGTGTCGTGCATCGAGCACACGACCACGAAGTGCTGTTTCA
ACTCGGTGCTGGCCCGGATCATCAACGAGCAGGGCCGGCTGCAGGTCATGAAGTGGTGGGGCACCGCAGA
GATGCCGGACTGTTCGGGCTTCACGATCGCCCAGTTGCAGGCGCTGGACTTCTCGCGCATGGACCTGACC
GAGTTCTACGCCTCCATTGTGCCCAAGCTGCCCAACGTCGGCGCGATTCAGGGCGGCAACTCTGGCCGCG
CGAGCAACTGCTACTACGGGGAAGGGAGATGCCAATGA
 Primer design