SecReT4
Protein ID: 121593903
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1530
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1586762..1587787 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA1W648
KEGG IDajs:Ajs_1530
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4.2e-75, Aligned region: 35..339
Protein Sequence: 341 a.a.     [Download]
>gi|121593903|ref|YP_985799.1| TraU family protein [Acidovorax sp. JS42]
MTRIPRALATTLLAALLLATGTAAGAAGAATCTGKFPNPITDICWSCILPLSIGSARIGNFGDQEDIDNP
SSPLCTCGVNPTIGLSIGFWEPARHVEAVRKPFCLTSLGGIDLDPGIPAPEAARFTRPEGDGNGGSFYQA
HFYVNPVLYYLEVVTDFPCLEKGSFDLAYLTEVDPLWADDELTLIINPDAALFANPVAIAACAADCVAAS
VGFGIREMFWCAGCQGGLYPMNGHVPYHMGGVRTAALMAQRLTAKMHRELIAWAWHGQAGLCGPYFAPVM
DKTAYKTQLTHPIPNTAKEAGKCCQPFGRTTVTWGAGKEYPVRGEDFAFLLFRKRNCCVGY
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1587787-1586762 Acidovorax sp. JS42 chromosome, complete genome
ATGACCCGCATCCCCCGCGCGCTGGCGACCACGTTGCTGGCCGCGCTGCTCCTGGCCACTGGAACTGCTG
CAGGCGCGGCGGGCGCGGCCACCTGCACCGGCAAGTTCCCGAATCCGATCACTGACATCTGCTGGAGCTG
CATCCTGCCGCTGAGCATCGGCAGCGCGCGCATCGGCAACTTCGGCGACCAGGAGGACATCGACAACCCC
TCGAGCCCGCTGTGCACCTGCGGCGTGAATCCCACCATCGGCCTGTCGATCGGATTCTGGGAACCCGCGC
GCCACGTCGAGGCCGTGCGCAAGCCCTTCTGCCTGACCTCCCTGGGCGGCATCGACCTCGATCCCGGCAT
CCCGGCGCCCGAGGCGGCGCGCTTCACCCGCCCCGAGGGTGATGGCAACGGCGGCAGCTTCTACCAGGCC
CACTTCTACGTGAACCCGGTCCTCTATTACCTGGAGGTCGTCACCGACTTCCCGTGCCTGGAGAAGGGCT
CGTTCGACCTGGCCTACCTCACCGAGGTCGATCCGCTGTGGGCCGACGATGAACTCACCCTGATCATCAA
TCCTGACGCGGCGCTATTCGCCAATCCGGTAGCGATCGCCGCGTGCGCCGCCGACTGCGTGGCGGCCTCG
GTGGGCTTCGGCATCCGGGAGATGTTCTGGTGCGCGGGCTGCCAGGGCGGCCTGTATCCGATGAACGGCC
ATGTCCCGTACCACATGGGCGGCGTGCGCACCGCGGCCCTGATGGCCCAGCGGCTGACGGCCAAGATGCA
CCGCGAGCTGATCGCCTGGGCCTGGCACGGCCAGGCCGGGCTGTGCGGGCCGTACTTCGCGCCAGTGATG
GACAAGACCGCCTACAAAACCCAGCTCACCCACCCCATCCCCAACACCGCGAAGGAAGCCGGCAAGTGCT
GCCAGCCCTTCGGCCGCACGACCGTGACCTGGGGCGCCGGGAAGGAGTACCCGGTGCGCGGCGAGGACTT
CGCCTTCCTGCTCTTCAGAAAAAGGAACTGCTGTGTCGGCTACTGA
 Primer design