SecReT4
Protein ID: 121593904
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1531
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1587784..1588422 [-]
Productmembrane lipoprotein lipid attachment site
Component typeTraW_F
UniProt IDA1W649
KEGG IDajs:Ajs_1531
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 3.1e-08, Aligned region: 7..37
Protein Sequence: 212 a.a.     [Download]
>gi|121593904|ref|YP_985800.1| membrane lipoprotein lipid attachment site [Acidovorax sp. JS42]
MKTLPPIALLVLAALACASTPAGATDLGALGPTYDIAEPHLLQMIEQRLREKERSGELARIEQDARARGT
EAIRSPAPVAGVQTTAKSRTFYFDPTYTLDRNILGAQGELLFAAGTKANPLDVVSLSRHLLFFDARDSRQ
VRQARELMARYQGKVKPILTGGSYLDLMKSWRIPVYYDQQGLLTRRLGISQVPALVSQEGKRLRIDEMEV
PR
 
Nucleotide Sequence: 639 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1588422-1587784 Acidovorax sp. JS42 chromosome, complete genome
ATGAAAACCCTTCCTCCGATCGCCCTCCTTGTCCTTGCCGCCCTGGCCTGCGCCAGCACCCCAGCGGGGG
CCACCGACCTCGGCGCGCTGGGCCCTACCTACGACATCGCCGAGCCCCACCTGCTGCAGATGATCGAGCA
GCGCCTGCGCGAGAAGGAACGCTCCGGCGAGCTGGCCCGCATCGAGCAGGATGCACGCGCTCGCGGCACC
GAAGCCATACGCAGCCCGGCCCCCGTTGCTGGCGTGCAGACCACAGCGAAGTCCCGCACCTTCTACTTCG
ACCCGACCTACACGCTGGACCGCAACATCCTTGGCGCCCAGGGCGAGCTGCTGTTCGCCGCCGGCACCAA
GGCCAATCCACTGGATGTGGTGTCGCTGTCGCGGCACCTGCTGTTCTTCGATGCCCGCGACAGCCGCCAG
GTCCGCCAGGCGCGCGAGCTGATGGCGCGCTACCAGGGCAAGGTCAAGCCGATCCTCACAGGCGGTTCCT
ACCTGGATCTGATGAAGTCCTGGCGTATCCCGGTCTACTACGACCAGCAGGGACTGCTGACGCGCCGGCT
CGGCATCTCGCAGGTGCCAGCCCTGGTTTCGCAGGAGGGCAAGCGGCTGCGCATCGACGAGATGGAGGTG
CCGCGATGA
 Primer design