SecReT4
Protein ID: 121593908
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1535
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1589748..1592330 [-]
Producthypothetical protein
Component typeTraC_F
UniProt IDA1W653
KEGG IDajs:Ajs_1535
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-64, Aligned region: 29..287
AAA_10 [PF12846], Evalue: 1.1e-47, Aligned region: 485..773
TrwB_AAD_bind [PF10412], Evalue: 8.4e-07, Aligned region: 484..550
FtsK_SpoIIIE [PF01580], Evalue: 5.1e-05, Aligned region: 456..522
Protein Sequence: 860 a.a.     [Download]
>gi|121593908|ref|YP_985804.1| hypothetical protein Ajs_1535 [Acidovorax sp. JS42]
MPFSSTDARPGSARAVPLFPFGMAADTPAEQFAGWLPYSAYLADEKIFANRDGMGFMLEVMPQSGADERM
AEVLVSLYANCPPGTGLQFHLFASPHVRHQLRQYTNLRVEDEDQAEKAREWGRPVPNENLFRKLARQRVN
HLLHGTQSSLTAGFHYTLRDFRLMLSVVFPGSAADLNRREALLALRDSMAATLRSAMLPNRVCDAADLIN
WCALFTNPDRIAHSDAEDLNHDDDHWLRYDDGREIRDQIVDFDTIQDPHPSGITLWKETSAEVLEARFYS
IKSFPERFALWQMGSLIGDLMQPALQYSAPFLITLGVHILDPNATKSIITANHVRATQNAKSKMADVMPD
VRKKLDDWSAAANAIDTGGSLVSLYHQLAIFTSPDKAASAHEAANAIWRARGFQLNADAYMHRQALLASL
PMTLTPRFHKDLAKMRRVTRKTMANAIHMAPLIAEWRGTRTPALVFGGRRGQVMTLDLFDNDLGNYNFAI
IGAPGSGKSVLMNELAWSYRAIGAKVWMLDLGRSFEKLCRKAQGTYIEFRPDVDICLNPFTIVHDINEDI
DMLVPGISKMCSMQHALDEVQYKAISAMVLKLWREHGNDLTITGLRDAFKTGTIEELGVTGDQRIRDLAI
MLNPYAKGGQYERFFEGRANVDFSNDFIVIENEELKRRPDLHAVVNILLLHQITGEMYLTRNRRKVLFID
ELKQQLGDIGADDPVKAAVVEEAARRARKYGGALGTATQSADDYYGSAQMEAAFNCSDWVFLLRQKPESI
EMLDRKGRLAMDEPKKRLLNSLRTEAGAFSELYISSPVGEGVARNILDPATHLLFSNKLEDNAPIDALRA
QGLSIDEAIAELLRQRGHAL
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1592330-1589748 Acidovorax sp. JS42 chromosome, complete genome
ATGCCGTTTTCCTCCACCGATGCACGACCCGGCAGCGCCCGCGCCGTGCCGCTGTTTCCGTTCGGCATGG
CTGCAGACACGCCCGCTGAGCAGTTCGCCGGCTGGCTGCCCTACTCCGCCTACCTCGCTGACGAGAAGAT
TTTCGCGAACCGCGACGGCATGGGCTTCATGCTCGAAGTCATGCCGCAGTCGGGCGCGGACGAACGCATG
GCCGAGGTGCTGGTCTCGCTCTACGCCAACTGCCCGCCGGGCACCGGCCTGCAGTTTCACCTGTTCGCCT
CACCGCACGTCCGCCATCAACTGCGCCAGTACACCAACCTGCGCGTCGAGGACGAGGACCAGGCGGAGAA
GGCACGCGAGTGGGGCCGTCCCGTTCCCAACGAAAACCTGTTTCGCAAGCTGGCGCGCCAACGCGTCAAC
CATTTGCTGCACGGCACCCAGTCCTCGCTCACGGCCGGCTTCCACTACACGCTGCGCGACTTCCGGCTGA
TGCTCAGCGTGGTGTTTCCCGGCAGTGCGGCCGACCTGAACCGGCGGGAGGCCTTGCTGGCATTGCGCGA
TTCGATGGCGGCCACGCTTCGCTCGGCCATGCTGCCCAACCGGGTCTGTGACGCGGCGGACCTGATCAAC
TGGTGCGCGCTATTCACCAACCCCGACCGGATCGCGCATTCGGATGCCGAGGATCTGAACCACGACGACG
ACCACTGGCTGCGCTACGACGACGGCCGCGAGATCCGCGACCAGATCGTGGACTTCGACACCATCCAGGA
CCCGCACCCGTCAGGCATCACGCTCTGGAAGGAAACCAGCGCCGAGGTGTTGGAAGCGCGCTTCTATTCG
ATCAAGAGCTTCCCCGAGCGATTCGCCCTCTGGCAGATGGGTTCTCTCATCGGCGACCTGATGCAGCCGG
CGCTGCAGTACAGCGCACCCTTCCTGATCACGCTGGGCGTGCACATCCTCGACCCGAACGCCACGAAGTC
CATCATCACGGCGAACCACGTGCGCGCCACGCAGAACGCCAAATCCAAGATGGCCGATGTGATGCCGGAC
GTGCGCAAGAAGCTCGACGACTGGTCGGCAGCGGCCAACGCCATCGACACCGGCGGCAGCCTGGTGAGCC
TATATCACCAGCTCGCCATCTTCACGTCGCCGGACAAGGCCGCCTCGGCGCACGAGGCCGCGAACGCCAT
CTGGCGGGCGCGTGGCTTCCAGCTCAATGCCGACGCCTACATGCACCGCCAAGCGCTGCTGGCCAGCCTG
CCGATGACGCTGACCCCGAGGTTCCACAAGGACCTCGCCAAGATGCGCCGCGTCACGCGCAAGACCATGG
CCAATGCCATCCACATGGCGCCGCTGATCGCCGAGTGGCGCGGCACGCGCACCCCGGCCCTGGTGTTCGG
CGGGCGGCGCGGCCAGGTCATGACGCTGGACCTGTTCGACAACGACCTGGGCAACTACAACTTCGCGATC
ATCGGCGCGCCCGGGTCGGGCAAGTCCGTGCTGATGAACGAGCTGGCCTGGTCGTACCGGGCGATCGGCG
CCAAGGTCTGGATGCTGGACCTGGGCCGCAGCTTCGAAAAGCTGTGCCGCAAGGCCCAGGGCACCTACAT
CGAGTTTCGGCCCGACGTGGACATCTGCCTGAACCCGTTCACCATCGTGCACGACATCAACGAGGACATC
GACATGCTGGTGCCGGGCATCAGCAAGATGTGCTCGATGCAACATGCGCTGGACGAGGTCCAGTACAAGG
CGATCTCCGCCATGGTGCTCAAGCTCTGGCGCGAGCACGGCAACGACCTGACGATCACCGGCCTGCGCGA
CGCCTTCAAGACCGGGACCATCGAGGAGCTCGGGGTCACGGGCGACCAGCGCATCCGGGATCTGGCCATC
ATGCTCAACCCCTATGCCAAGGGCGGGCAGTACGAGCGCTTCTTCGAGGGCCGTGCCAACGTCGATTTCA
GCAACGACTTCATCGTCATCGAGAACGAGGAATTGAAGCGCCGGCCCGACCTGCACGCCGTCGTCAACAT
CCTGCTGCTGCACCAGATCACCGGCGAGATGTATCTGACGCGCAACCGGCGCAAGGTGCTGTTCATCGAC
GAACTCAAGCAGCAACTCGGCGACATCGGCGCCGACGACCCGGTCAAGGCTGCCGTGGTCGAGGAAGCTG
CCCGGCGGGCGCGCAAGTATGGCGGCGCCCTGGGCACGGCCACGCAGTCTGCCGACGATTACTACGGCAG
CGCGCAGATGGAAGCGGCTTTCAACTGCTCGGACTGGGTGTTTCTGCTGCGCCAGAAGCCCGAATCCATC
GAGATGCTGGATCGCAAGGGGCGCCTGGCCATGGACGAGCCCAAGAAGCGGCTGCTCAATTCGCTGCGCA
CCGAGGCCGGGGCGTTCTCGGAGCTGTACATCTCGTCGCCCGTGGGCGAAGGCGTGGCTCGCAATATCCT
GGATCCGGCCACGCACCTGCTGTTCTCGAACAAGCTGGAGGACAACGCGCCCATCGATGCGCTGCGCGCC
CAAGGGTTGTCCATCGATGAGGCCATTGCCGAGCTGCTGCGCCAGCGGGGACATGCGCTATGA
 Primer design