SecReT4
Protein ID: 121593909
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1536
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1592338..1592979 [-]
Producthypothetical protein
Component typeTraV_F
UniProt IDA1W654
KEGG IDajs:Ajs_1536
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 7.5e-26, Aligned region: 29..142
Protein Sequence: 213 a.a.     [Download]
>gi|121593909|ref|YP_985805.1| hypothetical protein Ajs_1536 [Acidovorax sp. JS42]
MNARIARAVAAALLLPLAGCMNMSGLSGSSKYACAAPEGVACDSVSGTYTNALHNNLPSQQASAFRSESR
EGVPQEPAASPVRQPIAAAPRSMADGDAEGTPALALRSQARVLRLWTKPWEDADGDLWDQGYVYVQVDAG
RWQIDHVRQRIRDQYAPLRPPPAAAPATASGGAPAPSGPDAAVPVEGAIQRPASFNGFPSLAQPPAGLGP
RQQ
 
Nucleotide Sequence: 642 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1592979-1592338 Acidovorax sp. JS42 chromosome, complete genome
ATGAACGCGCGCATCGCACGCGCCGTCGCTGCCGCCCTGCTACTGCCGCTGGCGGGCTGCATGAACATGT
CGGGACTCTCCGGCAGCTCCAAATACGCCTGCGCCGCGCCCGAGGGCGTGGCCTGCGACTCGGTGTCGGG
CACCTACACCAACGCCCTGCACAACAATCTGCCGAGCCAACAGGCATCGGCGTTCCGCAGCGAGTCTCGG
GAAGGTGTTCCGCAGGAGCCCGCCGCATCGCCCGTGCGACAGCCGATTGCCGCGGCACCGCGCAGCATGG
CCGACGGCGACGCGGAAGGCACCCCTGCGCTGGCGCTGCGCTCCCAGGCCCGGGTTCTGCGCCTATGGAC
CAAGCCCTGGGAGGACGCCGACGGCGATCTCTGGGACCAGGGGTATGTCTACGTGCAGGTCGATGCCGGC
CGCTGGCAGATCGACCATGTGCGCCAGCGCATCCGCGATCAATATGCACCGTTGCGCCCTCCACCAGCGG
CTGCACCCGCCACGGCATCCGGTGGCGCGCCAGCACCTTCCGGGCCTGACGCCGCCGTCCCGGTTGAAGG
CGCCATCCAACGCCCCGCCTCGTTCAACGGCTTCCCGTCACTTGCCCAACCGCCGGCAGGCCTGGGCCCT
CGACAGCAGTGA
 Primer design