SecReT4
Protein ID: 121593911
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1538
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1593808..1595226 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA1W656
KEGG IDajs:Ajs_1538
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-44, Aligned region: 245..440
Protein Sequence: 472 a.a.     [Download]
>gi|121593911|ref|YP_985807.1| TraB pilus assembly family protein [Acidovorax sp. JS42]
MNTPSMPSGPSGTGRPSSHAVRRWLERLSPRQRQYALLAAILGGGIGLLWMIFSFAGSDAKPHGGRAAQT
QPGDVTNIGVMPPGGQVNPVDQWVGTAGRKLAQYETEREAQSRVNKDREAFENKTLQRFAELEKRLTSAQ
QAAASPPPAPTPPPPAPAPAAPTTMPPAAGLPPAPSPGTGAMPSGMPTFQGMAVATPPTPVISRVTLAER
RRPSAEGSGDGSHQAEGANQASNAPKTVSTFLPVSFTRGILLGGLDAPTGGQSQANPHPVLIRLSDNSVL
PNQFRGEYRECFVVAAGYGDISSERAYLRTENLSCVRADGATLEVRIQGSVYGEDGKVGMRGRLVTKQGQ
MLANALLAGVVSGIGQGLSTANTTYSSSPLGTMASTDSNADAYRAGLGHGVGKALDRLAQYYIKLAENTF
PVIEVDAGRQIDVVITKGVRIDVPMTAVAERGQRRTASPETRYLETTDDGNY
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1595226-1593808 Acidovorax sp. JS42 chromosome, complete genome
ATGAACACCCCTTCCATGCCTTCGGGGCCGTCCGGAACCGGACGGCCATCCAGCCATGCCGTGCGCCGCT
GGCTGGAGCGGCTGTCGCCCCGCCAGCGCCAGTACGCGCTGCTGGCCGCCATCCTGGGCGGCGGGATCGG
CCTGCTGTGGATGATCTTCAGCTTCGCGGGAAGCGATGCCAAGCCGCACGGCGGCCGCGCGGCACAGACC
CAGCCCGGCGACGTCACCAACATCGGCGTGATGCCACCAGGCGGCCAGGTCAATCCGGTGGACCAGTGGG
TCGGCACGGCGGGACGCAAGCTGGCCCAGTACGAGACCGAGCGCGAGGCACAGAGCCGGGTCAACAAGGA
CCGCGAGGCCTTCGAGAACAAAACCCTGCAGCGATTCGCGGAGCTGGAGAAGCGGCTGACCAGCGCCCAG
CAAGCTGCAGCGTCGCCTCCTCCCGCGCCCACGCCCCCGCCACCGGCGCCTGCACCGGCAGCCCCGACCA
CCATGCCGCCCGCAGCCGGCCTGCCGCCTGCGCCGTCCCCGGGCACGGGGGCCATGCCCTCCGGTATGCC
CACGTTCCAGGGCATGGCCGTGGCCACGCCGCCCACGCCCGTGATCTCCCGTGTGACGCTCGCCGAGCGC
CGCCGGCCATCCGCCGAGGGCAGCGGCGACGGCAGCCACCAGGCCGAGGGAGCCAACCAGGCATCGAACG
CCCCCAAGACGGTGTCCACCTTCCTGCCCGTGAGCTTCACGCGCGGCATCCTGCTGGGCGGCCTCGATGC
GCCCACGGGTGGGCAATCCCAGGCCAACCCGCATCCAGTGCTGATCCGCCTGTCGGACAACAGCGTGCTG
CCCAACCAGTTCCGCGGCGAATACCGCGAGTGCTTCGTGGTGGCAGCGGGCTATGGCGACATCAGCTCGG
AGCGCGCCTACCTGCGCACCGAGAACCTCTCATGCGTGCGCGCCGACGGCGCCACGCTGGAAGTGCGCAT
CCAGGGTTCGGTCTACGGCGAGGACGGCAAGGTCGGCATGCGTGGGCGGTTGGTCACCAAGCAGGGCCAG
ATGCTGGCCAACGCGCTGCTGGCCGGTGTGGTCAGCGGCATCGGCCAGGGCCTGTCCACCGCCAACACCA
CCTACAGCAGTTCCCCGCTCGGGACCATGGCCAGCACCGACAGCAATGCCGATGCCTACCGGGCGGGCCT
GGGCCACGGTGTCGGCAAAGCACTGGACCGGCTGGCCCAGTACTACATCAAGCTGGCCGAGAACACCTTC
CCGGTCATCGAGGTCGACGCCGGCCGTCAGATCGACGTCGTGATCACCAAGGGCGTGCGCATCGATGTCC
CGATGACGGCAGTCGCCGAGCGCGGCCAGCGCCGCACCGCTTCCCCCGAAACCCGCTACCTGGAGACCAC
CGATGATGGCAACTACTGA
 Primer design