SecReT4
Protein ID: 121593913
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1540
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1596217..1596783 [-]
Productplasmid-like conjugative transfer protein TraE
Component typeTraE_F
UniProt IDA1W658
KEGG IDajs:Ajs_1540
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.6e-31, Aligned region: 1..184
Protein Sequence: 188 a.a.     [Download]
>gi|121593913|ref|YP_985809.1| plasmid-like conjugative transfer protein TraE [Acidovorax sp. JS42]
MDFDRLRGDLKDMRRRNRGLGLAVGALAAGLFLALAIIINLLGTVRTVVVPPSLSKTFWVTSDRASSEYL
EQMGSFVAWLILDVTPSTIDWKKDILLGYVDPAQYGPLKTRQEVEAERLKRINAATAFAPQQLVASEDTQ
SLVVRGRLRTLVNGMETANDLKAYRIEFGHAAARMHVIGFKEVPYAVK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1596783-1596217 Acidovorax sp. JS42 chromosome, complete genome
ATGGACTTCGACCGGCTCAGAGGCGACCTCAAGGACATGCGCCGCCGCAACCGGGGCCTGGGCCTCGCCG
TCGGGGCACTGGCCGCCGGCCTGTTCCTGGCGCTCGCCATCATCATCAACCTGCTGGGCACGGTACGCAC
CGTCGTCGTGCCGCCCTCGCTCAGCAAGACGTTCTGGGTCACCAGCGACCGTGCCTCCAGCGAATACCTG
GAGCAGATGGGCAGCTTCGTCGCCTGGCTGATCCTGGACGTGACGCCTTCCACTATCGACTGGAAGAAGG
ACATCCTGCTGGGCTACGTCGACCCGGCCCAGTACGGCCCGCTCAAGACACGCCAGGAGGTCGAGGCCGA
GCGGCTCAAGCGCATCAACGCCGCCACCGCCTTCGCACCCCAGCAGCTCGTTGCCAGCGAAGACACCCAG
TCGCTCGTCGTGCGCGGGCGGCTGCGCACCCTGGTCAACGGCATGGAGACCGCCAACGACCTCAAGGCCT
ATCGCATCGAGTTCGGCCATGCCGCGGCTCGCATGCACGTCATCGGATTCAAGGAGGTGCCCTATGCGGT
CAAGTGA
 Primer design