SecReT4
Protein ID: 121593914
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1541
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1596798..1597097 [-]
ProductTraL family protein
Component typeTraL_F
UniProt IDA1W659
KEGG IDajs:Ajs_1541
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 9.8e-30, Aligned region: 5..99
Protein Sequence: 99 a.a.     [Download]
>gi|121593914|ref|YP_985810.1| TraL family protein [Acidovorax sp. JS42]
MQADTYIPRRLDDQWKIGFWDVDVAAPIVLAFFIGYLSASKAAFAVCMAAGIAVSRWIARLKSDKHPAFA
LHWLYWHLPVNPATAMRATPPSHIRRMVG
 
Nucleotide Sequence: 300 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1597097-1596798 Acidovorax sp. JS42 chromosome, complete genome
ATGCAAGCGGACACCTATATCCCGCGGCGTCTGGACGACCAGTGGAAGATCGGCTTCTGGGACGTCGACG
TCGCCGCGCCCATCGTCCTGGCTTTCTTCATCGGCTACCTGTCGGCCAGCAAGGCCGCGTTCGCGGTCTG
CATGGCGGCCGGCATCGCCGTCTCGCGCTGGATCGCGCGGCTGAAGTCGGACAAGCATCCGGCCTTCGCG
CTGCACTGGCTGTACTGGCACCTGCCGGTCAATCCCGCCACTGCCATGCGCGCCACGCCGCCCTCGCACA
TCCGCCGCATGGTCGGCTGA
 Primer design