SecReT4
Protein ID: 121593917
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1544
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1598008..1598535 [-]
Productlytic transglycosylase catalytic subunit
Component typeOrf169_F
UniProt IDA1W662
KEGG IDajs:Ajs_1544
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|121593917|ref|YP_985813.1| lytic transglycosylase catalytic subunit [Acidovorax sp. JS42]
MRLLAVFMVAMLPAASALATCWDTAAQRYGIAPELLYAVARTESSLNPRAVNRAHEKRTGSYDIGLMQIN
SRHLSRLAGFGIREADLYDPCVNLQVGAWLMADSFARHGVSWNAVGAYNAACTQLKGDACTQARATYAWK
VYRHLPSARGVDQGTRQKATAVVAQSQGLRVRVSP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1598535-1598008 Acidovorax sp. JS42 chromosome, complete genome
ATGCGCTTGCTTGCCGTATTCATGGTGGCGATGCTGCCAGCCGCTTCAGCCCTGGCCACGTGCTGGGACA
CGGCGGCGCAACGCTACGGCATCGCGCCGGAGTTGCTCTACGCCGTCGCCCGTACCGAGTCGAGCCTGAA
TCCGCGTGCGGTGAACCGCGCGCATGAGAAGCGCACGGGCAGCTACGACATCGGCCTGATGCAGATCAAT
AGCCGGCATCTGTCCCGGCTGGCTGGCTTCGGCATTCGCGAAGCCGACCTGTACGACCCCTGCGTGAACC
TGCAGGTGGGGGCGTGGCTGATGGCTGACAGCTTCGCGCGGCACGGCGTCAGCTGGAACGCCGTGGGCGC
CTACAACGCAGCATGCACCCAGCTCAAAGGGGACGCCTGCACACAGGCCAGAGCCACCTATGCATGGAAG
GTGTACCGGCATCTGCCGTCAGCGCGTGGTGTGGATCAGGGTACACGGCAGAAGGCCACCGCCGTCGTGG
CGCAAAGCCAGGGCCTGCGCGTGAGGGTTTCGCCATGA
 Primer design