SecReT4
Protein ID: 121593922
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1549
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1600735..1602636 [-]
Producthypothetical protein
Component typeTraD_F
UniProt IDA1W667
KEGG IDajs:Ajs_1549
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.2e-19, Aligned region: 167..203
TrwB_AAD_bind [PF10412], Evalue: 4.2e-19, Aligned region: 455..610
AAA_10 [PF12846], Evalue: 1.6e-12, Aligned region: 169..554
TraG-D_C [PF12696], Evalue: 2.5e-12, Aligned region: 474..599
Protein Sequence: 633 a.a.     [Download]
>gi|121593922|ref|YP_985818.1| hypothetical protein Ajs_1549 [Acidovorax sp. JS42]
MLVRRYEMPWRRAFEAHAGLVWLAASLYFAIIALVGPLPVLPSLGLAAACLLMACRRTAQAVRILRLRGS
LGGRRIQVLSAQELGLLCADPAQVFLGFGFEWRPVHAQRLYELSKVDYREFKVPGWLQHALGQGGAAQPD
AEIGLPYIHGVEPTEHALRRPLQNFEGGTLLVGTTQSGKGVALANLITQAVRRGDVVIVIDPKNSRRLKR
VVERACEDYREADTFMEFHPAFPERGVRLDFTFNWQKPTEIASRIQSIMPPDTAGAFTAFGWDAVNVVVQ
GLVELEERPNLIKLTKYIEGGIEPVLEASLRRFYEQLLGNGWRDQPEMRKLLHDAHRGNMRKPSEAASAD
LMGFVAYYEHHVAQNQRNKVLDAQVRTFRHNREHYQKITANLLPILSMLTSGDLGRSLSPDPFDADDPRP
IMNFEKIERGGHVLYMCLDSLPDPSVASAIGALALADQAARAGMRYNLGTYRRISLFVDEVSNVINQPLI
EILNKGAEGGIFATCAMQTLADLARRLGSEDAARMALGNLNNLIALRTKDRPTQDFVVETFGKTAIHTVR
VGLSHGADTHIGDFSSSYSTQLTESFEEVVPADILGKLPNLQYFASVSGGRIIKGRFPIINPDADAQPRG
AAA
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1602636-1600735 Acidovorax sp. JS42 chromosome, complete genome
ATGCTGGTGCGCCGCTACGAAATGCCCTGGCGCCGCGCCTTCGAGGCCCATGCGGGCCTGGTGTGGCTGG
CCGCCTCGCTCTACTTCGCGATCATCGCGCTGGTCGGCCCATTGCCTGTCCTTCCCTCACTCGGACTGGC
TGCCGCCTGCCTGCTGATGGCGTGCCGGCGCACGGCCCAGGCGGTACGGATACTGCGGCTGCGCGGATCC
CTCGGCGGGCGCCGCATCCAGGTGCTGAGCGCGCAGGAACTGGGACTTCTGTGCGCCGATCCGGCCCAGG
TGTTCCTGGGCTTCGGCTTCGAGTGGCGACCGGTGCATGCACAGCGTCTCTACGAACTCTCCAAGGTGGA
CTACCGCGAGTTCAAAGTGCCCGGGTGGCTGCAGCATGCCCTGGGGCAAGGTGGCGCCGCACAGCCCGAT
GCGGAAATCGGCCTGCCCTACATCCACGGGGTAGAGCCGACCGAACATGCACTGCGCCGGCCGTTGCAGA
ACTTCGAAGGCGGCACGCTCCTCGTCGGCACCACGCAGTCGGGCAAGGGCGTGGCACTGGCCAACCTGAT
CACCCAGGCCGTGCGCCGCGGCGACGTCGTGATCGTGATCGATCCCAAGAACAGCCGCCGCCTCAAGAGG
GTCGTCGAGCGGGCCTGCGAGGACTACCGCGAGGCGGACACCTTCATGGAGTTCCACCCCGCCTTTCCGG
AGCGCGGCGTCCGCCTGGACTTCACGTTCAACTGGCAAAAGCCCACCGAGATCGCATCGCGCATCCAGTC
CATCATGCCGCCCGACACGGCTGGGGCGTTCACGGCCTTCGGCTGGGACGCCGTCAACGTGGTGGTACAG
GGCCTGGTCGAGCTGGAAGAGCGGCCGAACCTCATCAAGCTCACCAAGTACATCGAGGGCGGCATCGAGC
CGGTGCTGGAGGCCTCGCTGCGGCGCTTCTACGAGCAATTGCTGGGCAATGGCTGGCGCGACCAGCCCGA
GATGCGCAAGCTGCTGCACGATGCGCACCGGGGCAACATGCGCAAGCCCTCCGAGGCGGCGAGCGCCGAC
CTGATGGGCTTCGTCGCCTACTACGAGCACCACGTTGCGCAGAACCAGCGCAACAAGGTGCTCGATGCCC
AGGTGCGCACGTTCCGGCACAACCGGGAGCACTACCAGAAGATCACGGCGAACCTGTTGCCGATCCTCTC
GATGCTGACCTCAGGTGACCTGGGTCGCAGCCTGTCACCCGACCCTTTCGATGCCGACGATCCACGCCCA
ATCATGAATTTCGAGAAGATCGAACGCGGCGGCCACGTGCTCTACATGTGTCTGGATTCGCTGCCCGATC
CGTCGGTCGCCTCGGCCATCGGTGCACTGGCCCTGGCCGACCAGGCCGCCCGGGCCGGCATGCGCTACAA
CCTAGGCACCTACCGGCGCATCTCGCTGTTCGTGGACGAGGTCAGCAACGTCATCAACCAGCCGCTGATC
GAGATTCTGAACAAGGGAGCAGAAGGCGGCATCTTCGCGACCTGCGCCATGCAGACCCTGGCCGACCTGG
CACGCCGCCTGGGGAGCGAGGATGCAGCCCGCATGGCGCTGGGCAACCTGAACAACCTGATCGCGCTGCG
CACCAAGGACCGGCCCACGCAGGACTTCGTGGTCGAGACCTTTGGCAAGACGGCGATCCACACGGTACGC
GTGGGCCTGAGCCACGGGGCCGACACGCATATCGGGGACTTCTCGTCGAGCTATTCGACCCAGCTCACCG
AGAGCTTCGAGGAGGTGGTGCCGGCGGACATCCTTGGCAAGCTGCCGAACCTGCAGTACTTCGCGTCGGT
ATCGGGCGGCCGCATCATCAAGGGCCGCTTCCCGATCATCAATCCGGATGCGGATGCACAGCCACGGGGA
GCGGCCGCATGA
 Primer design