SecReT4
Protein ID: 121593923
T4SS name [ID]Tra_F [600]
Gene symbol-
Locus tagAjs_1550
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]1602638..1604431 [-]
ProductFHA domain-containing protein
Component typeTraI_F
UniProt IDA1W668
KEGG IDajs:Ajs_1550
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 1.1e-89, Aligned region: 30..340
Protein Sequence: 597 a.a.     [Download]
>gi|121593923|ref|YP_985819.1| FHA domain-containing protein [Acidovorax sp. JS42]
MAPGTSSSSTSVQPFASSDPGFEALPLATVIAGHQALLGRIKLCFGADRATFEHELMPLVQGYARFVHLL
PATADNYFHTPGGLLQLGLETAFFSLQGTDAHIFSGRATISERRELEPRWRIATFIGGLCCELHRTLTHL
IVTTADGEEWPAFLGGLAPWLEQRAADRYFVRWRANARESRGVGLFALAHVVPAEVLQMLGDGNSLVVPQ
LLASIAGVPQYREHNVLDELVRRSMALVIDRNLLASADRYGKPQYGSHLERYLVDALRRLAAGHSTWTPN
RDKSRVWLGPEGLFLVWPGAAEDALSLLESDQLVGIPKSPQTLLELLLEAKVFVATGTGRETWDIQPPGA
KTSIEAVKLANPSILLAGLEPQPTALTANLVPSPSPPTKPPAQAANAKSAVAGDSPAAMASVSSPPTTPP
PDVPAAAAPAEQLSLLDATGTTDAPETGPQEAPTVVEAPASVPSRAEPTAICLRAPMRLNPAVRKALADI
VATLNDGASASDICTVAEGVFVPLADFEKRGVQASIAIRALDDTRMIRRPQPGGPPTVTRQIRGTAVVGV
ILVATHVEGLDPAAFGLTAQGGALTPFGATAAQQRGL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c1604431-1602638 Acidovorax sp. JS42 chromosome, complete genome
ATGGCTCCCGGCACCTCATCGTCCAGCACCAGCGTACAACCCTTCGCATCCTCGGATCCCGGCTTCGAAG
CACTGCCCTTGGCCACGGTCATCGCGGGACACCAGGCGCTTCTGGGCCGGATCAAGCTGTGCTTCGGCGC
GGATCGCGCCACCTTCGAGCACGAGCTGATGCCATTGGTTCAGGGCTATGCACGTTTCGTGCACTTGCTT
CCCGCCACCGCCGACAACTATTTCCACACGCCCGGCGGTCTGCTGCAACTCGGGTTGGAAACAGCCTTCT
TCAGCCTGCAGGGCACGGACGCACACATCTTCTCCGGCCGTGCGACGATCTCCGAGCGCCGTGAACTGGA
GCCGCGCTGGCGAATCGCGACCTTCATAGGCGGCCTGTGCTGCGAACTGCACCGGACGCTGACCCACCTC
ATCGTGACCACGGCGGACGGCGAGGAGTGGCCGGCATTCCTGGGAGGTCTGGCGCCGTGGCTGGAGCAGC
GAGCAGCCGATCGCTACTTCGTGCGCTGGCGCGCCAATGCACGAGAGTCCCGCGGCGTGGGCCTGTTCGC
CCTGGCCCACGTCGTCCCGGCAGAAGTGCTACAAATGCTGGGAGATGGCAATTCCCTGGTGGTACCGCAG
CTGTTGGCCAGCATCGCGGGCGTCCCCCAGTACCGCGAGCACAACGTCCTGGACGAACTCGTGCGCCGGT
CGATGGCACTGGTCATCGACCGGAACCTGCTGGCGAGCGCCGACCGTTACGGCAAGCCTCAGTATGGCTC
TCACCTCGAGCGCTATCTCGTGGACGCGCTGCGCCGCCTCGCCGCCGGCCATTCCACATGGACGCCGAAC
CGCGACAAGAGCCGTGTCTGGTTGGGGCCGGAGGGGTTGTTCCTGGTCTGGCCGGGGGCTGCGGAGGATG
CGCTGTCTCTGCTGGAAAGCGACCAATTGGTCGGTATCCCGAAATCGCCCCAGACCCTGCTGGAGTTGCT
GCTCGAGGCGAAGGTATTCGTGGCGACCGGCACCGGCCGCGAAACCTGGGACATCCAGCCGCCGGGAGCG
AAGACGTCGATCGAAGCTGTGAAGCTCGCCAATCCGTCTATCTTGCTGGCGGGCCTTGAGCCACAGCCCA
CCGCCCTGACCGCAAACCTCGTTCCTTCGCCTTCACCACCAACGAAGCCACCTGCTCAGGCAGCCAATGC
GAAGTCCGCAGTAGCTGGGGATTCACCCGCAGCCATGGCGAGCGTGTCGTCACCGCCAACCACGCCCCCA
CCCGACGTACCCGCAGCAGCCGCGCCAGCAGAACAGCTATCGCTGCTGGATGCCACCGGCACTACCGACG
CGCCTGAAACTGGGCCGCAAGAGGCCCCCACCGTGGTTGAAGCACCGGCTTCAGTCCCTTCGAGGGCGGA
GCCAACCGCCATATGCCTGCGAGCGCCGATGCGCCTGAACCCTGCCGTGCGCAAAGCCCTGGCCGACATC
GTGGCGACCCTCAATGACGGTGCCTCTGCGTCGGATATCTGCACTGTGGCCGAGGGCGTCTTTGTGCCGC
TGGCCGATTTCGAAAAGCGCGGGGTGCAGGCAAGCATCGCGATCCGTGCGCTCGACGATACGCGGATGAT
CCGGCGTCCGCAGCCAGGTGGCCCGCCAACGGTCACACGCCAGATCCGCGGCACCGCCGTGGTAGGCGTG
ATCCTGGTGGCCACGCATGTCGAAGGCCTGGATCCTGCGGCCTTTGGCCTCACCGCCCAGGGAGGCGCGC
TCACCCCTTTCGGCGCTACCGCCGCACAGCAGCGAGGCCTCTGA
 Primer design