SecReT4
Protein ID: 121594526
T4SS name [ID]Tfc [730]
Gene symbol-
Locus tagAjs_2181
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2309029..2310435 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA1W7X1
KEGG IDajs:Ajs_2181
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|121594526|ref|YP_986422.1| hypothetical protein Ajs_2181 [Acidovorax sp. JS42]
MNASLPDFLRRAKSPLRATLLVAAITLAVGVAWAQTRIDPNGVNVSGSMIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATAAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLAEGMALRDAVSSTDAVSAIEQAESNKGNNGV
PWVGGGNAGGSGQSSIKVVGDVTRAGYNLLNGRSATDTSSIARSACGNRLTCQTWSSPGAAAAFANRVLG
EREQRTCENCTKTQTTPGVGLTPVIQEEYETKLQVLQELVTGARPTTLANLDAAGSSSLPITRGVIEALR
DEPDQDVLGRRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREVQKPRSGTP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2310435-2309029 Acidovorax sp. JS42 chromosome, complete genome
ATGAACGCCTCCCTCCCTGACTTCCTGCGCCGCGCGAAATCGCCCCTGCGGGCCACGCTGCTCGTGGCGG
CCATCACGCTGGCCGTCGGCGTCGCCTGGGCGCAGACCCGCATCGATCCCAATGGCGTGAACGTCAGCGG
CAGCATGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCGATGGGTGGTGCCGGC
AACATGCAGAGCATCGGCGTCGGCGTCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCACCA
CGACGCTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACGATCATGAGCAACGTGATCCAGAA
CGCCACTGCCGCGGTGGCGTCACTCCCGGCGCTCATCATCCAGCGCGCCGACCCGGGCCTGTACAACCTG
CTCACCAACGGCATCCTCCAGGCGCGCCTGGATTTCGACCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ATCGCATGGCGGACATGGCCGGCGGCCAGGCCGGCTGGGACCAGCTCGCCGAAGGGATGGCGCTGCGGGA
TGCGGTCAGCAGCACCGATGCCGTCTCCGCCATCGAGCAGGCCGAGTCCAACAAGGGGAACAACGGCGTG
CCCTGGGTCGGCGGCGGCAACGCGGGCGGCTCCGGCCAGAGTTCGATCAAGGTGGTCGGCGACGTGACGC
GCGCGGGCTACAACCTGCTCAACGGGCGCAGCGCCACCGATACCTCGTCGATCGCGCGCAGCGCCTGCGG
CAACCGCCTGACCTGCCAGACCTGGTCGTCGCCTGGCGCGGCCGCGGCCTTTGCGAACCGCGTGCTGGGC
GAACGCGAGCAACGCACCTGCGAAAACTGCACGAAGACCCAGACCACGCCTGGCGTCGGGCTCACGCCAG
TGATCCAGGAAGAGTACGAGACCAAGCTGCAGGTGTTGCAGGAACTGGTGACGGGCGCCCGGCCGACGAC
ACTGGCCAATCTCGACGCGGCCGGCAGCAGCTCGCTGCCGATCACCCGCGGCGTGATCGAGGCCCTGCGT
GACGAGCCCGACCAGGACGTGCTGGGCCGGCGCCTCGCGTCCGAGGCTGCGCTGTCCAGCGTGCTGGAGA
AGGCCCTGCTGCTGCAACGCACGTTGCTGACCGGCAAGAAGGAGCCGAACGTCGCCGCCAACGAGCTCGC
CGTGCAGGCGGTGGACCAGGAGAACAGCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAG
CTGCGCCGCACGCTGGCCGGCAACTCGGCGATGGCGATCATCCAGCGCCACAGCACCCGCGCTGCCGGCT
CGCGCGGCGTCTTCGAGGGCGACACCACGCGCGACCGTCTGCGGGAAGTCCAGAAGCCGCGGAGCGGTAC
GCCATGA
 Primer design