SecReT4
Protein ID: 121594536
T4SS name [ID]Tfc [730]
Gene symbol-
Locus tagAjs_2191
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2319778..2320188 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA1W7Y1
KEGG IDajs:Ajs_2191
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.9e-49, Aligned region: 12..133
Protein Sequence: 136 a.a.     [Download]
>gi|121594536|ref|YP_986432.1| hypothetical protein Ajs_2191 [Acidovorax sp. JS42]
MAVPSETPQDTLVTFLPHRLNRQPVVVRGLTADELWICTGLSAAAGFALGLPLAWLTHSIAMVPTLIVAG
IALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRYPALAALLGGQRLITRSGYWTTRRNADRGAP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2320188-2319778 Acidovorax sp. JS42 chromosome, complete genome
ATGGCCGTCCCTTCGGAGACCCCGCAAGACACGCTGGTGACCTTCCTGCCGCACCGGCTGAACCGCCAGC
CGGTGGTCGTGCGCGGGCTGACCGCCGACGAGTTGTGGATCTGCACCGGCCTGTCGGCCGCAGCCGGATT
CGCGCTCGGCCTGCCGCTGGCCTGGCTCACGCACAGCATCGCCATGGTGCCGACGCTGATCGTCGCCGGT
ATCGCGCTGGGCGTCTTCGTCGGCGGCGGCTTCCTGCGCGCGCAGAAGCGCGGCCGGCCCGACACCTGGC
TGTACCGGCAGCTCCAGTGGCGGCTGGCCCTGCGGTATCCGGCGCTGGCGGCACTCCTGGGCGGGCAGCG
CCTCATCACCCGCTCGGGCTACTGGACGACCCGGCGCAACGCCGATCGAGGTGCGCCATGA
 Primer design