SecReT4
Protein ID: 121594539
T4SS name [ID]Tfc [730]
Gene symbol-
Locus tagAjs_2194
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2320828..2321187 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA1W7Y4
KEGG IDajs:Ajs_2194
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.8e-32, Aligned region: 28..106
Protein Sequence: 119 a.a.     [Download]
>gi|121594539|ref|YP_986435.1| hypothetical protein Ajs_2194 [Acidovorax sp. JS42]
MGQTNRRASAWPSLVVLLAVSLSALQPAIADDAPEREQLAALARQLDLIDRIAEHAASTAPQERARYHFD
YARLRADLKRVRAGLQDYLVPQRAQPRDPVPLAGDYVRHDRADDEAPSP
 
Nucleotide Sequence: 360 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2321187-2320828 Acidovorax sp. JS42 chromosome, complete genome
ATGGGACAGACCAACCGCCGCGCATCCGCATGGCCTTCGCTGGTCGTGCTGCTGGCCGTGTCGCTCTCGG
CCCTGCAGCCCGCCATTGCCGACGACGCTCCTGAGCGTGAGCAGCTCGCTGCGCTCGCCCGCCAACTCGA
CCTGATCGACCGCATCGCCGAGCACGCCGCCAGTACCGCTCCCCAGGAACGCGCCCGCTACCACTTCGAC
TACGCCCGGCTGCGCGCAGACCTGAAGCGCGTTCGCGCCGGCCTGCAGGACTACCTCGTGCCCCAGCGCG
CCCAGCCGCGCGATCCCGTCCCGTTGGCCGGCGATTACGTCCGCCACGACCGCGCCGACGACGAGGCGCC
ATCGCCATGA
 Primer design