SecReT4
Protein ID: 121594552
T4SS name [ID]Tfc [730]
Gene symbol-
Locus tagAjs_2207
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2341585..2342334 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA1W7Z7
KEGG IDajs:Ajs_2207
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.2e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|121594552|ref|YP_986448.1| hypothetical protein Ajs_2207 [Acidovorax sp. JS42]
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHAQGMLHYELDQ
LSTHFTRSALVQEPGRTAHRLVELGYDWLFVKSGLLDWIRDASAQAGAGSHRPTKDFRYYIGLVYVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLMTAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2342334-2341585 Acidovorax sp. JS42 chromosome, complete genome
ATGAGCGATCCGGCCGTCGCTGCCCAGCGCCAGCAGCAACGACAGCAGGGGCTGATCGCCGGCCTGGTCA
CGCTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATGCGTCGG
CATGCACTTCTTCTGGCCCGAGCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTCTCCACGCATTTCACGCGCAGCGCGCTGGTGCAGGAGCCGGGGCGCACCGCGCACCGGCTGGTCGAAC
TGGGCTACGACTGGCTGTTCGTGAAGAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGCGCAGGCCGG
CGCCGGCAGCCATCGCCCGACCAAGGATTTCCGCTACTACATCGGCTTGGTCTACGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTACACGACGCTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCCTGC
CGTTGTTCCTGATGACCGCCTTCGTCGGACTGGTGGACGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAATCGGGGTTCATCTATCACCGCGCCAGGGCCAGCCTGATCCCGCTGGCCGTGCTGCCG
TGGGTGACTTACCTGGCACTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGCTGCCCAGCGCCGCACTGC
TCGGCGTGGCGGTGTGCATCGCGGCGGCGACGTTCAAGAAGTACTTGTGA
 Primer design