SecReT4
Protein ID: 121594555
T4SS name [ID]Tfc [730]
Gene symbol-
Locus tagAjs_2210
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2345026..2345646 [-]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDA1W800
KEGG IDajs:Ajs_2210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|121594555|ref|YP_986451.1| lytic transglycosylase catalytic subunit [Acidovorax sp. JS42]
MAAAIGAPGRERRPSRIAIRCASAMLLLTTGGWALAALAREVPPPAYQLAAHRADVPAAVLYAVALQESG
AMLRGRLIPWPWTLNVAGSPQRYATRAEACAGLHRALAHTPANRIDAGLGQVNLGYHAHRYTQPCELLDP
YRNLAIAAEILREQHTPGEDWLLAIGRYHRPAGGAPAARYRRSVHRHLTRVLDPDVPVPTLQATTP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2345646-2345026 Acidovorax sp. JS42 chromosome, complete genome
ATGGCAGCGGCAATAGGTGCTCCGGGCCGGGAGCGTCGGCCGTCCCGCATCGCCATCCGCTGCGCCAGCG
CCATGCTGCTGCTCACCACCGGCGGCTGGGCATTGGCCGCCCTGGCGCGGGAAGTGCCGCCGCCGGCCTA
TCAACTGGCGGCGCACCGTGCAGACGTGCCGGCGGCGGTGCTGTACGCGGTGGCCTTGCAGGAGAGCGGC
GCCATGCTGCGCGGGCGCCTGATCCCCTGGCCGTGGACGCTCAACGTCGCCGGCTCGCCACAGCGCTATG
CCACCCGCGCCGAGGCCTGCGCGGGGCTGCACCGTGCCCTCGCTCACACGCCGGCCAATCGCATCGACGC
CGGCCTCGGCCAGGTCAATCTCGGCTACCACGCGCATCGCTACACGCAGCCCTGCGAGCTGCTGGACCCG
TACCGCAACCTCGCCATCGCTGCGGAAATCCTGCGCGAACAGCACACGCCGGGCGAGGACTGGCTGCTTG
CCATCGGCCGCTACCACCGGCCCGCCGGCGGGGCACCCGCGGCGCGCTACCGGCGCAGTGTGCATCGGCA
CCTGACCCGCGTGCTCGACCCCGACGTTCCCGTTCCAACCCTCCAGGCCACCACGCCATGA
 Primer design