SecReT4
Protein ID: 121594874
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2536
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2701523..2703121 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDA1W8W9
KEGG IDajs:Ajs_2536
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-37, Aligned region: 62..275
Protein Sequence: 532 a.a.     [Download]
>gi|121594874|ref|YP_986770.1| TrbL/VirB6 plasmid conjugal transfer protein [Acidovorax sp. JS42]
MKVLSKAALIGVAIALYSTAASAQLTNQGMLDQVVTEFATRATSWQTVVMNAAMFLFWTLGTISLVFTFG
FMALRKADIGEFFAEFIRFILFFGFFLWLLRNGPAFANSIIQSLARIGEQASGVASVTPSGIVDIGFMIL
KQAFINSSIWSPVDSFIGVALSLGILILLAVVAINMLLLLVSGWLLMYAGIFFLGFGGSRWTSDMAINYY
KTVLGVAVQIMTMVLLVGIGNDLLSSFYARMNTGTLNFEELGVMLVFCVALLMLVNRVPPLVAGIITGSG
IGGAGGIGNFGAGAAIGAAMGAASMAAGAASVAGAAVMGGATSAAGGMSAIKAAFEKAGASAGGESGGVP
MFGGGAGGDSDVGSFAQAAGFGGGGSSAGTSTPLGQAAGFYSSGSSSSSGSSGGESRGGDKAGSSSKGSG
DGGGSKAGGGSDAGGQAGRGAGSLVAATAANLVQGIGDVAKAKAASIRDAAAERIADTTGGKIAAAIRAS
SQTDQAVEDVPSFGGNSLAGADSAAADPDDEVAAFANRDKEV
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2703121-2701523 Acidovorax sp. JS42 chromosome, complete genome
ATGAAAGTTCTGTCCAAAGCGGCGCTGATCGGCGTCGCCATCGCGCTCTACTCCACCGCCGCATCGGCCC
AGCTCACCAACCAGGGGATGCTTGACCAGGTGGTGACGGAGTTCGCCACGCGGGCCACGTCCTGGCAGAC
GGTGGTAATGAATGCCGCGATGTTCCTGTTCTGGACGCTGGGCACGATCTCGCTGGTTTTTACCTTCGGC
TTCATGGCGCTGCGCAAGGCCGACATTGGCGAGTTCTTTGCCGAGTTCATCAGGTTCATCCTGTTCTTCG
GCTTCTTCCTCTGGCTGTTGCGCAACGGCCCGGCCTTCGCTAACTCGATCATCCAGTCACTGGCCCGGAT
CGGCGAGCAGGCGTCCGGGGTGGCGTCGGTGACACCCTCGGGCATCGTGGATATCGGCTTCATGATCTTG
AAGCAGGCATTCATCAACTCGTCGATCTGGTCGCCCGTGGATAGTTTCATCGGTGTGGCATTGAGCCTCG
GCATCCTGATCCTGCTGGCTGTCGTCGCCATAAACATGTTGCTGTTGCTCGTGTCGGGCTGGCTGCTGAT
GTACGCCGGTATCTTCTTTCTCGGCTTCGGCGGCTCGCGTTGGACATCCGACATGGCGATCAACTACTAC
AAGACCGTGCTGGGCGTGGCCGTGCAGATCATGACGATGGTGCTCCTGGTCGGCATCGGGAACGACTTGC
TTTCCAGCTTCTACGCCAGGATGAACACCGGCACCCTCAACTTTGAAGAGCTGGGCGTGATGCTGGTTTT
CTGCGTGGCGTTGCTCATGCTGGTCAATCGTGTGCCCCCGCTTGTCGCCGGCATCATCACCGGCTCGGGC
ATCGGTGGCGCTGGCGGCATTGGCAACTTCGGTGCAGGTGCCGCCATCGGTGCGGCTATGGGCGCGGCGA
GCATGGCCGCCGGAGCGGCCAGCGTGGCTGGCGCGGCCGTGATGGGCGGTGCGACCTCGGCCGCCGGCGG
CATGTCGGCGATTAAGGCGGCGTTCGAGAAAGCAGGGGCTAGCGCCGGTGGCGAATCGGGCGGAGTGCCC
ATGTTTGGTGGTGGTGCTGGCGGTGATTCCGATGTTGGATCGTTCGCGCAGGCGGCGGGCTTTGGTGGCG
GCGGTTCCAGTGCCGGCACAAGTACGCCGCTCGGCCAGGCGGCCGGCTTTTACAGCTCTGGAAGCTCCAG
CAGTTCGGGCAGCAGCGGCGGCGAATCGAGGGGCGGCGACAAAGCCGGCTCCAGCTCGAAGGGTAGCGGC
GATGGCGGCGGCTCGAAGGCCGGCGGCGGCAGCGACGCCGGCGGCCAAGCCGGCCGAGGTGCGGGAAGCC
TTGTCGCTGCGACGGCTGCGAACCTGGTGCAAGGCATTGGCGACGTTGCGAAGGCCAAGGCGGCCAGCAT
CCGCGACGCCGCCGCCGAACGCATCGCCGACACCACAGGCGGGAAGATCGCCGCCGCGATCCGGGCGAGC
AGTCAGACAGACCAGGCGGTGGAGGATGTGCCCAGCTTCGGCGGCAACAGCCTGGCAGGGGCCGATTCGG
CTGCTGCTGATCCTGATGATGAAGTGGCCGCGTTCGCCAACCGCGACAAGGAGGTATGA
 Primer design