SecReT4
Protein ID: 121594875
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2537
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2703118..2703387 [-]
Productputative entry/exclusion protein TrbK
Component typeTrbK
UniProt IDA1W8X0
KEGG IDajs:Ajs_2537
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 89 a.a.     [Download]
>gi|121594875|ref|YP_986771.1| putative entry/exclusion protein TrbK [Acidovorax sp. JS42]
MKKTMLLAGLVVVLVAGCDNKPAIPPMPEVNDTNCQIEAIKKIEDRAAREKFAGLCSRRSPAGGGIAPTE
KPMNWLELADPKDQKEAKP
 
Nucleotide Sequence: 270 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2703387-2703118 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGAAAACGATGCTGCTTGCCGGCCTCGTGGTGGTGCTGGTGGCTGGTTGTGACAACAAGCCGGCCA
TCCCGCCCATGCCCGAGGTCAATGACACCAATTGCCAGATCGAGGCGATCAAGAAGATCGAGGACAGGGC
CGCGCGCGAAAAATTCGCCGGACTGTGCTCGCGCCGGTCGCCGGCCGGCGGCGGCATCGCGCCGACCGAG
AAGCCCATGAACTGGCTCGAACTGGCCGACCCTAAAGACCAGAAGGAGGCGAAGCCATGA
 Primer design