SecReT4
Protein ID: 121594876
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2538
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]2703403..2704188 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1W8X1
KEGG IDajs:Ajs_2538
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 261 a.a.     [Download]
>gi|121594876|ref|YP_986772.1| conjugal transfer protein TrbJ [Acidovorax sp. JS42]
MKHVRLLAAKTALAAVLAGSIIITPAQAGIPVIDGGNLIQNVMTAIESVAQTLKQIEQYQTQLQQYENML
QNTMAPAAYIWDQAQSTINGLMAATDTLNYYRNQLGSVDAYLGKFQDVAYYRGSPCFSAAGCSDAERAAM
EQNRSLASESQKKANGALFKGLEQQQRNLTADARQLERLQSAAQGATGQMQAIGFANQLAANQANQLLQI
RGLLIAQQNAATARMQAQADLEAQQQAAGATSRESRIERTASPKNWLELTR
 
Nucleotide Sequence: 786 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c2704188-2703403 Acidovorax sp. JS42 chromosome, complete genome
ATGAAACACGTCCGCCTTTTAGCGGCTAAAACCGCGCTCGCCGCCGTCCTGGCCGGCAGCATCATCATCA
CGCCCGCGCAGGCCGGCATCCCCGTCATCGACGGCGGCAATCTGATTCAGAACGTCATGACCGCCATCGA
GTCGGTGGCGCAGACGCTCAAGCAGATTGAGCAGTACCAGACCCAATTGCAGCAGTACGAAAACATGCTG
CAAAACACGATGGCGCCGGCGGCCTACATCTGGGATCAGGCGCAGTCCACCATCAACGGCTTGATGGCCG
CCACCGACACGCTGAACTACTACAGGAATCAGCTCGGTAGCGTCGATGCGTACCTGGGCAAGTTCCAGGA
CGTGGCCTACTACCGTGGTTCGCCGTGCTTCTCGGCTGCCGGGTGCTCGGATGCGGAGCGCGCCGCGATG
GAGCAAAACCGCAGCCTGGCGAGCGAGAGCCAGAAGAAAGCGAACGGCGCGCTTTTCAAGGGTCTTGAGC
AACAGCAGCGCAACCTTACTGCTGACGCTCGCCAGCTCGAACGGCTCCAGTCGGCCGCGCAGGGTGCGAC
CGGCCAGATGCAAGCCATCGGCTTCGCTAATCAGCTCGCCGCCAACCAGGCAAACCAGCTCCTGCAAATC
CGTGGCCTGCTGATCGCGCAGCAGAACGCCGCGACGGCCAGGATGCAGGCGCAGGCCGACCTAGAGGCGC
AACAGCAGGCCGCCGGCGCGACTTCCCGGGAGTCCAGGATCGAGCGCACGGCCAGCCCGAAGAACTGGCT
CGAACTGACCCGCTGA
 Primer design