SecReT4
Protein ID: 121595223
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2902
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3076590..3077852 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA1W9W8
KEGG IDajs:Ajs_2902
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.6e-57, Aligned region: 224..406
Protein Sequence: 420 a.a.     [Download]
>gi|121595223|ref|YP_987119.1| conjugation TrbI family protein [Acidovorax sp. JS42]
MSQDDSPDLAPQAGKVVPEAVALRAQPRPVTRLNRRTLVMLTGGLSVAVLGATIWSLQPHRRAGEQTELY
NVDRVSKSEGLDGLPSDYSKLPKVPELGPPLPGDLGPAIVKSQQPVAPTYAPPGHDPEDARRKEAEAAAA
SSVFFRSGTPGKTAAPATAQVGAAGQASALAGFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLKGGSTE
TRNSGNLKMPSSPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYNSQ
VSYGQSRVQVVWNRIILPDTSSLTLDNLVGTDPAGYSGLEDGVDYHWSRIVAGAALTTLLGVGAELAAPE
NRQDGNRIIIAGRDSAQDSINQVGQEMTRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPMFFQRGAMQ
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3077852-3076590 Acidovorax sp. JS42 chromosome, complete genome
ATGAGCCAGGACGATTCCCCTGACCTTGCACCGCAGGCGGGCAAGGTCGTGCCCGAGGCGGTGGCGCTGC
GCGCCCAGCCGCGCCCGGTCACACGCCTGAACCGGCGCACGCTAGTCATGCTCACCGGCGGCCTGTCGGT
CGCCGTGCTCGGGGCCACGATCTGGTCATTGCAGCCGCACCGGCGCGCGGGTGAGCAGACCGAGCTGTAC
AACGTCGATCGCGTGTCGAAGTCCGAAGGGCTGGATGGCTTGCCTTCGGATTACTCCAAGCTGCCGAAGG
TGCCGGAACTGGGGCCGCCGCTGCCGGGCGACCTTGGCCCGGCCATCGTGAAGTCGCAGCAGCCCGTGGC
GCCCACCTACGCGCCGCCGGGCCACGACCCGGAGGATGCACGGCGCAAGGAAGCTGAAGCGGCAGCAGCT
TCCTCGGTGTTCTTCCGCTCGGGCACGCCTGGCAAGACCGCCGCGCCAGCGACTGCGCAAGTCGGTGCGG
CTGGCCAAGCATCGGCCTTGGCGGGCTTCGACCCGCTGGCCGCCGGGCCAGCCTCGACGGCGGCTCAGCC
TGCCGACCCGACCGCTGTGCAAAACCGGCAAGACCAAAAAGAGGCGTTCCTGAAGGGCGGCTCTACGGAG
ACCCGCAATTCCGGGAATCTGAAAATGCCGTCCTCGCCGTATCAGGTGATGGCCGGGACGGTGATCGCCG
GCGCGCTGGTGACGGGCATCAAGTCGGACTTGCCGGGCGACGTGATCGCCACGGTGACGGAGCCGGTCTA
TGACACGGCCACGGGCAAGTTCCTGCTGATTCCGCAGGGCTCGCGCATCCTGGGCAAGTACAACAGCCAG
GTGAGCTATGGGCAAAGCCGGGTTCAGGTGGTTTGGAACCGCATCATCCTGCCGGACACGTCCTCGCTGA
CGCTAGACAACCTCGTGGGCACCGATCCGGCCGGCTATTCCGGCCTGGAAGACGGGGTGGACTACCACTG
GAGCCGCATCGTCGCCGGTGCCGCGCTGACGACGCTGCTGGGCGTGGGCGCCGAGCTGGCCGCGCCGGAG
AACCGGCAGGACGGTAATCGCATCATCATCGCCGGCCGCGACAGCGCGCAGGACAGCATCAATCAGGTCG
GCCAGGAGATGACCCGGCGCAACATGAACATCCAGCCGACGCTGACTGAACGGCCCGGCCTGCCGGTGCG
GATCATCGTCAACCGCGACTTGGTGTTGCGGCCGTACCAGCCGATGTTCTTCCAGCGGGGAGCGATGCAA
TGA
 Primer design