SecReT4
Protein ID: 121595224
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2903
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3077854..3078834 [-]
Productconjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDA1W9W9
KEGG IDajs:Ajs_2903
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-66, Aligned region: 100..319
Protein Sequence: 326 a.a.     [Download]
>gi|121595224|ref|YP_987120.1| conjugal transfer protein TrbG/VirB9/CagX [Acidovorax sp. JS42]
MNDLFRKFALPIMLLALAGCATQGKPPPSISLDEPVQAQPLPEPPAPVEVVAMPQVLPMPAQMKPVPDAK
PAAESADETVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVIVLQPGEELVTVAAGD
TVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVITTSRRTYLIELTSTEKTWMASVSWEYPKDKMLAL
QRQAQAASAAAPVDSGLLLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQG
DGQLMNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRKN
 
Nucleotide Sequence: 981 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3078834-3077854 Acidovorax sp. JS42 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATTCGCCTTGCCGATCATGTTGCTTGCCCTCGCGGGCTGCGCCACGCAGG
GCAAGCCGCCGCCGTCCATTTCGCTCGACGAGCCGGTGCAGGCCCAGCCGCTACCGGAGCCGCCTGCGCC
GGTGGAGGTGGTGGCCATGCCGCAAGTGCTGCCGATGCCGGCTCAGATGAAGCCTGTGCCGGATGCCAAG
CCCGCCGCAGAATCCGCCGATGAAACCGTGCGGGTGTCCCGCGCCAACGCCGAGGCGCGTATCGCGCCCA
CGCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCCTTCACTGATGGCGCGCTGTATCAGGTCTATGC
GGCCGTGGGCCGCGTGACCGTGATCGTGCTTCAGCCAGGCGAGGAACTGGTGACGGTGGCTGCTGGCGAC
ACGGTGCGCTGGATCGTGGGCGACACATCGAGCGGCAGCGGCGATGCGCTGCGCGTCAATGTGATGGTCA
AGCCGATCCGCTCGGGCCTCAAGACCAATCTGGTCATCACGACCAGCCGGCGCACGTACCTGATTGAGCT
GACTTCGACCGAGAAGACGTGGATGGCGTCGGTGTCCTGGGAGTATCCGAAGGACAAGATGCTGGCCTTG
CAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCGCCGGTCGATAGCGGGCTATTGCTGGAGAAGATCCGTT
TCCGCTACGCGGTCAGTGGCAGCAACCCGCCGTGGAAACCGCTGCGCGCCTTCGATGATGGCGAGAAGGT
CTATATCCAGTTCCCGCCGGGCATCGCCCAGGGCGAGTTGCCACCGCTGTTCGTCATCGGCGCGCAAGGT
GACGGGCAACTGATGAACTACCGTTTCCGCTCGCCGTACTACATCGTGGATCGCCTGTTCGGCGCGGCCG
AACTGCGCCTGGGCGGGGACAAGGGCGACGTGGTGCGGATTGAGCGCACGGACGGCACAAGGAAGAATTG
A
 Primer design