SecReT4
Protein ID: 121595225
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2904
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3078831..3079535 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA1W9X0
KEGG IDajs:Ajs_2904
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.1e-60, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|121595225|ref|YP_987121.1| conjugal transfer protein TrbF [Acidovorax sp. JS42]
MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARVADPFTRIGKESVTVQITSVTRASDTSFNVRWTETRFVNGALDRTERWNAVVSIVQQTPRTEQRVRK
NPLGIYVNGLSWSRELEGNEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3079535-3078831 Acidovorax sp. JS42 chromosome, complete genome
ATGCGATTCAAACGACCGCAGGTGCGCTACGCCGACACGCCGCAGCCTGCCACTCCGTACCAATCCGCAG
CTCAGGTCTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCCAGGAATTGGCGCTTCATGGCCTTTGG
CTGCCTCACCTTGGCCGTGCTGATGGCCGGCGGCCTGGTCTGGCGCTCGGCGCAGTCCATCGTGACGCCC
TACGTGATCGAGGTGGACAACGCGGGCCAGGTGCGCGCCGTCGGCGAGGCCGCCACGCCGTACCGGCCTA
GCGATGCGCAGATTGCCTACCACCTCGGCCGCTTCATCGGCCTGGTGCGCTCGCTGTCCATCGATCCCAT
CGTGGTACGGCAGAACTGGCTGGATGCCTACGACTACACGACCGACAAGGGGGCGGTCGTGCTCAACGAG
TACGCGCGGGTGGCCGATCCGTTCACGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCACCAGCGTGA
CCCGCGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAGACGCGCTTTGTCAACGGCGCGCTGGATCG
CACCGAACGCTGGAACGCCGTGGTGTCCATCGTGCAGCAGACGCCGCGCACCGAGCAGCGCGTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGAAGGAAACGAAGGAGCAAAGC
CATGA
 Primer design