SecReT4
Protein ID: 121595226
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2905
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3079554..3080888 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA1W9X1
KEGG IDajs:Ajs_2905
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.3e-49, Aligned region: 37..265
Protein Sequence: 444 a.a.     [Download]
>gi|121595226|ref|YP_987122.1| conjugal transfer protein TrbL [Acidovorax sp. JS42]
MNDISIIDHFLDVFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAGLFWAMSHASGQGEDVIAKLIRKVLY
VGAFAYIIGNFNTLASIVFRSFAGLGLTASGSTLSMGNFLQPGRLAKVGIDAGAPILEQIKEMAGFPEVF
IHIMPIVVLFFAWMVVIVSFFVLAVQLFVTLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFSEFNIPAGSEPSIDRALVIMLASLAMLALGIFGPGIATGLVSGGPQLGAGAMAGA
AIGAAGTAVAVGAAATGVGSAVAAGARMAPAVARSMASTASSARSAYQAGSASAGGGLKGAAAGVGNVAK
TGAQAAGQKVADGARSMKERMAAAFRPDDTPASGAAPAGPDAAGSSPSAEQPAWAERLHRKQQLTHAATT
AAHTLRGGDGGSSSQGPSLRDSDS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3080888-3079554 Acidovorax sp. JS42 chromosome, complete genome
ATGAATGACATTTCGATCATTGACCATTTTCTCGATGTCTTCTCGCGCTACATCGACTCGGGCTTCGGGC
TGCTGCACGGCGAGGTGGCATTTCTCACGGCCACGCTGATCGTCATCGACATGACGCTCGCCGGGCTGTT
CTGGGCCATGAGTCATGCCAGCGGCCAGGGCGAGGACGTGATCGCCAAGCTGATCCGCAAGGTGCTTTAT
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACACCTTGGCGAGCATCGTGTTCCGCTCGTTCGCCG
GGCTGGGCCTGACGGCCAGCGGCTCGACCCTGAGCATGGGTAACTTCTTGCAGCCGGGACGGCTCGCCAA
AGTGGGCATCGACGCCGGGGCGCCCATTCTTGAGCAGATCAAGGAGATGGCGGGCTTCCCCGAGGTGTTC
ATTCACATCATGCCCATCGTCGTGCTGTTCTTCGCATGGATGGTGGTCATCGTCAGCTTCTTCGTGCTGG
CGGTGCAGCTCTTCGTGACGCTGATCGAGTTCAAGCTGACCACGCTGGCGGGCTTCGTGCTGGTGCCGTT
CGCCCTCTGGAACAAGACGGCGTTCCTGGCCGAGAAGGTGTTGGGCAACGTGGTGTCCTCGGGCATCAAG
GTTCTGGTGCTGGCCGTCATCGTTGGCATCGGCTCGGGGCTGTTCTCCGAGTTCAACATACCGGCCGGTT
CGGAGCCTTCGATCGACCGGGCGTTGGTCATCATGCTGGCCTCGCTCGCCATGCTGGCCCTGGGCATCTT
CGGGCCGGGCATTGCGACTGGGCTGGTGTCCGGTGGCCCGCAGCTCGGCGCGGGCGCGATGGCTGGTGCT
GCTATCGGCGCAGCCGGAACCGCCGTGGCAGTCGGTGCCGCGGCTACGGGCGTCGGCAGTGCTGTGGCGG
CTGGGGCACGCATGGCACCCGCCGTCGCCCGCTCGATGGCATCGACGGCCAGCAGCGCCAGGTCGGCGTA
CCAGGCGGGCTCCGCCTCGGCCGGTGGTGGCCTCAAGGGCGCCGCCGCTGGTGTGGGCAATGTGGCCAAG
ACCGGCGCGCAGGCGGCCGGGCAGAAGGTGGCCGACGGGGCGCGCTCGATGAAAGAGCGCATGGCGGCGG
CTTTTCGGCCTGACGACACGCCGGCATCCGGCGCCGCACCCGCCGGGCCTGACGCTGCCGGCTCATCTCC
GTCCGCCGAGCAACCCGCCTGGGCCGAGCGCCTGCATCGCAAGCAGCAGCTTACCCATGCCGCAACCACC
GCCGCCCACACGCTGCGCGGCGGCGATGGTGGCAGCTCCAGCCAGGGGCCGAGCCTGCGCGATTCCGATT
CCTGA
 Primer design