SecReT4
Protein ID: 121595228
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2907
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3081220..3081948 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA1W9X3
KEGG IDajs:Ajs_2907
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.9e-10, Aligned region: 2..39
Protein Sequence: 242 a.a.     [Download]
>gi|121595228|ref|YP_987124.1| conjugal transfer protein TrbJ [Acidovorax sp. JS42]
MKKRLLAAAVAAMLCTATAVQAQWVVIDPTNLVQNTLTAIRTLEQINNQIKQLQHEAQMLINQARNLASL
PSSVVGQLRANLATTQRLIAQAKGLAYDVTNLDREFQRLYPERYAATVSGNQMYRDAQERWKNTLSGLQT
TMQMQAQASQNLSDDEGVLADLVGKSQSAVGALQAMQAMNQLLALQAKQSIQTQRLSITQDRAASLELAR
QAAAVERGREVNRRFLGEGTPYTPQSVDFYSR
 
Nucleotide Sequence: 729 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3081948-3081220 Acidovorax sp. JS42 chromosome, complete genome
ATGAAGAAGCGTCTTCTCGCCGCCGCCGTCGCGGCCATGCTTTGCACCGCTACCGCCGTGCAGGCGCAAT
GGGTCGTGATCGACCCTACGAACCTCGTGCAGAACACGCTGACCGCGATCCGCACGCTGGAGCAGATCAA
CAACCAGATCAAGCAGCTCCAGCACGAAGCGCAGATGCTCATCAACCAGGCGCGCAACCTCGCCAGCCTG
CCGTCCAGCGTAGTGGGCCAGTTGCGCGCCAACCTGGCGACCACGCAGCGGCTGATCGCGCAGGCCAAGG
GCCTGGCCTATGACGTGACCAATCTGGATCGGGAGTTCCAGCGCCTGTACCCGGAGCGGTACGCCGCCAC
CGTCAGCGGCAATCAGATGTACCGCGACGCGCAGGAGCGTTGGAAGAACACGCTCAGCGGCCTGCAGACC
ACCATGCAGATGCAGGCCCAGGCGTCGCAGAACCTGAGCGACGACGAAGGCGTGCTGGCCGACCTCGTGG
GCAAGAGCCAGTCGGCCGTGGGCGCTTTGCAGGCGATGCAGGCCATGAACCAGCTTCTGGCCTTGCAGGC
CAAGCAGTCCATCCAGACGCAGCGCCTGAGCATCACCCAGGATCGTGCCGCTTCGCTGGAACTGGCGCGG
CAGGCCGCCGCTGTGGAGCGAGGCCGCGAGGTGAACCGGCGCTTCCTGGGTGAAGGCACGCCGTACACGC
CGCAGTCCGTCGATTTCTACAGCCGTTGA
 Primer design