SecReT4
Protein ID: 121595229
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2908
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3081945..3084380 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA1W9X4
KEGG IDajs:Ajs_2908
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.3e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 2.8e-15, Aligned region: 181..388
DUF853 [PF05872], Evalue: 3.5e-08, Aligned region: 594..684
Protein Sequence: 811 a.a.     [Download]
>gi|121595229|ref|YP_987125.1| conjugal transfer ATPase TrbE [Acidovorax sp. JS42]
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRMG
SGWALFIEAERRPAADYPHSEFPEPLSWLVDEERRATFEDSGNHFESGYHLTLVYLPPEESRARAAGMLY
ENRPTEGVDWRERLTAFVAETDRIFDLLDGVMPEIAWLDDSQTLTFLHATISTRRCRVGVPEVPFHIDAL
LTDSALVGGLAPMLGGQHLRVVSVRGFPTSTWPGILDDLNRLGFGYRWSTRFLCMDKADAEKELFRLRRQ
WFAKRKNVIALLRETIFQQETPLVDTDASNKSADADAALQELGSDQVAFGYVTTTVTVLDAEPAKADEKL
RMVERVIQGRGFVTMPEALNAVDAWLSSIPGHAYANVRQPIVSTLNLAHLMPVSAVWAGPERNNHLNGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRILAFDMGRSIRATVLGLG
GEHYDLGMDGEIAFQPLARIDHEGYRTWAAEWVEGRLVHEGVTVGPEEKAAIWSALGSLAGAPLEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADSDRLGSGAVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRAIYEGFGLNSRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGAATLAFAGASTPQDQRDIDA
VLAATSASTPFAAAWLRHRGLHWAAELLSSFPSTHPKENPS
 
Nucleotide Sequence: 2436 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3084380-3081945 Acidovorax sp. JS42 chromosome, complete genome
ATGCTGAACCTTGCCGAATATCGCCAGCGCCCGGCCTTGCTCGCCGACTGGTTGCCCTGGGCCGGGCTGA
TCGCACCGGGCGTCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGATAGCGCAACGCAAGGCGAACTGATTGCCACGTCGGCGCGCTTGAACAACGCGCTGCGTCGTATGGGT
TCGGGCTGGGCGCTGTTCATCGAAGCCGAGCGCCGGCCCGCAGCCGACTATCCGCACTCGGAGTTTCCCG
AGCCGTTGTCGTGGCTGGTGGACGAGGAACGCCGCGCTACGTTCGAGGACTCGGGCAACCACTTCGAGAG
CGGCTACCACCTGACGCTGGTGTACCTGCCGCCCGAGGAATCACGCGCCCGCGCGGCCGGGATGCTGTAC
GAGAACCGGCCCACCGAAGGCGTGGACTGGCGCGAGCGCCTGACGGCCTTCGTCGCGGAAACCGATCGCA
TCTTCGACCTGCTCGATGGCGTGATGCCGGAAATCGCGTGGCTGGACGACAGCCAGACGCTGACCTTCCT
GCACGCCACCATCTCGACGCGGCGCTGTCGCGTCGGCGTGCCTGAAGTGCCTTTCCACATCGATGCGCTG
CTGACCGACTCCGCGCTGGTCGGTGGCCTGGCGCCCATGCTGGGCGGCCAGCACCTGCGCGTGGTGTCGG
TGCGTGGCTTCCCGACCTCGACTTGGCCGGGGATTCTGGATGACCTCAACCGCCTCGGCTTTGGCTATCG
CTGGTCCACCCGGTTCCTCTGCATGGACAAAGCCGATGCGGAAAAGGAGCTGTTCCGCCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTGATCGCGCTGCTGCGCGAAACCATCTTCCAGCAGGAAACCCCGCTGG
TCGATACCGACGCCAGCAACAAATCGGCCGATGCGGACGCGGCCTTGCAGGAACTGGGCAGCGATCAGGT
GGCCTTCGGGTATGTCACCACCACGGTGACGGTGCTCGATGCCGAACCGGCGAAGGCCGACGAGAAGCTG
CGCATGGTGGAGCGGGTCATCCAGGGCCGGGGCTTCGTGACGATGCCCGAGGCCTTGAACGCGGTGGATG
CCTGGCTGTCGTCCATTCCCGGCCATGCCTACGCCAACGTGCGCCAGCCCATCGTCTCGACGCTGAACTT
GGCGCACCTGATGCCGGTGTCGGCGGTATGGGCCGGCCCCGAGCGCAATAACCATCTCAACGGCCCGCCG
CTGATCGTGACGCGCACCGACGGCGCGACACCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTCGCGGGGCCGACCGGCATGGGCAAGTCGGTGCTGCTCGCCACCTTGGCGATGCAGTTCCGGCG
CTATCGCGGATCGCGCATCCTCGCGTTCGACATGGGCCGCTCCATCCGGGCAACGGTGCTGGGCCTGGGC
GGCGAGCACTACGACCTCGGTATGGATGGCGAGATCGCCTTCCAGCCCCTGGCCCGCATCGACCATGAGG
GCTATCGGACGTGGGCCGCCGAGTGGGTCGAAGGCCGGCTGGTGCATGAAGGCGTGACCGTCGGCCCGGA
GGAGAAGGCTGCCATCTGGTCGGCGCTCGGCAGCCTCGCCGGTGCTCCGCTGGAGCAGCGCACGATGACC
GGCCTGTCGGTGCTGCTGCAATCGAACGCGCTGCGCCAGGCGCTCGCGCCCTACGTGCTCGGCGGCGCCC
ACGGCAAGCTGCTGGATGCGGATTCGGATCGCCTGGGTTCCGGCGCCGTGCAGTGCTTCGAGATGGAAGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCACTACCTCTTTGCCCGGTTCGATGAACGCTTT
GACGGTGCGCCCACGCTGCTGATCCTCGATGAGGCGTGGCTGTTTCTCGATGACCCGGTGTTCGCGGCCC
GCATCCGCCAGTGGCTCAAGACGCTGCGCAAGAAGAACGTCAGCGTCATCTTCGCCACGCAGAGCCTGGC
CGACATCAAGGATTCGAGCATCGCGCCGGCCATCATCGAGAGCTGCGCCAGCCGCATCTTCCTGCCCAAC
CCGCAGGCGACCGAGCCGCAGATCAGGGCTATCTACGAAGGCTTCGGGCTGAACTCGCGCCAGATCGAAA
TCGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGTCTCGGCAACCGCCTGTTCGACCT
CGACCTGGGCGCCGCGACCTTGGCCTTCGCGGGTGCTTCCACGCCGCAAGACCAGCGCGACATCGACGCG
GTGCTCGCCGCTACATCTGCATCCACCCCGTTCGCAGCCGCCTGGCTGCGCCACCGCGGCCTGCATTGGG
CGGCCGAACTGCTGTCCTCGTTCCCGTCCACCCACCCCAAGGAGAACCCATCATGA
 Primer design