SecReT4
Protein ID: 121595230
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2909
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3084390..3084662 [-]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDA1W9X5
KEGG IDajs:Ajs_2909
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.4e-11, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|121595230|ref|YP_987126.1| putative conjugal transfer TrbD transmembrane protein [Acidovorax sp. JS42]
MNGPHDGIPGFEVPLHRSLTEPILMGGAPRTVAITNGTLAAAVGLGLQMWIPGLVLWIVGHSLAVWGARV
DPQFMAVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3084662-3084390 Acidovorax sp. JS42 chromosome, complete genome
ATGAACGGCCCACACGATGGAATACCCGGCTTCGAGGTGCCGCTACATCGGTCTCTGACCGAGCCGATCC
TGATGGGCGGCGCTCCGCGCACCGTGGCCATCACCAACGGCACCTTGGCCGCTGCCGTGGGCCTGGGCTT
GCAGATGTGGATTCCTGGGCTGGTGCTTTGGATCGTCGGCCATTCGCTGGCGGTCTGGGGTGCGCGTGTC
GATCCGCAGTTCATGGCCGTGTTCGCGCGGCACATCAAGCACCGGCCGCTGCTGGACGTGTGA
 Primer design