SecReT4
Protein ID: 121595232
T4SS name [ID]Trb [239]
Gene symbol-
Locus tagAjs_2911
StrainAcidovorax sp. JS42
Repliconchromosome [GenBank: NC_008782] [Browse all T4SS(s) in this replicon]
Location [Strand]3085033..3086067 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA1W9X7
KEGG IDajs:Ajs_2911
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.6e-80, Aligned region: 26..292
TrwB_AAD_bind [PF10412], Evalue: 7e-07, Aligned region: 141..185
FtsK_SpoIIIE [PF01580], Evalue: 2.9e-05, Aligned region: 145..203
Protein Sequence: 344 a.a.     [Download]
>gi|121595232|ref|YP_987128.1| type II secretion system protein E [Acidovorax sp. JS42]
MSAVPSFTAVSLDRRILMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWIDRLSSGRAPMGVELSEADGER
IIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAFGVIPLSRYIEDEMMTAAQA
GLLVRAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRQGVVSMT
ELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSVLGALLRLEQLILEVAVNPPRALI
AEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYQLADALEAPFPELLPQSDLSSLSPDHSGELP
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|121592436|ref|NC_008782.1|:c3086067-3085033 Acidovorax sp. JS42 chromosome, complete genome
ATGAGCGCCGTTCCTTCCTTCACCGCCGTTTCACTGGATCGCCGCATCCTGATGCTGCGCACGGCGATGG
GGCCGCTGATCGCCGCCGCGCTGGAAGACCCGGACGTGGTGGAAATCATGCTCAACCCGGATCGCACCTT
GTGGATCGACCGGCTTTCGTCGGGTCGCGCGCCGATGGGTGTGGAGCTGTCCGAGGCCGACGGCGAACGA
ATCATCCGGCTGGTCGCGGCCCACGTCGGCGCGGAAGTCCACCGCGGCCAGCCACTGTTGACGGCGGAAC
TGCCCGAGACGGGCGAACGCTTCGAGGGCATCCTGCCGCCCGCTGCGCCGGGGCCGGCCTTTGCGTTGCG
CAAGCGCGCCTTTGGCGTGATCCCGCTGTCGCGCTACATCGAGGACGAAATGATGACCGCCGCGCAGGCG
GGCTTGCTGGTGCGCGCCGTGCGCGAACGCCAGAACATCCTGATCGCCGGCGGGACGAGTACCGGCAAGA
CCACCTTGGCCAATGCGCTATTGGCCGAGATCGCCGCCACGGGCGACCGCGTATTGGTGCTCGAAGACAC
GGTGGAGCTGCAATGCGCGGCCCGCGACCACGTGCCGCTGCGCACACGCCAGGGCGTGGTGTCCATGACC
GAGCTGGTGCGATCTTCGATGCGCCTGCGCCCGGATCGTGTCGTCGTCGGCGAGGTGCGTGGCGCCGAGG
CATTGGATCTCATCAAAGTCTGGGGCACTGGCCATCCGGGCGGCATCGCCACCATCCACGCCGGCTCCGT
ACTGGGCGCACTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCCCGTGCGCTGATC
GCGGAAGCGGTCAACGTGGTGATCCACATCGCCGGGCGCGGACGCAAGCGCCGCATCGAGAGCATCGCCC
GCGTCGTCGGCTTCGATGGCGTGGGCTACCAACTGGCGGATGCGCTGGAGGCTCCATTCCCGGAGCTGCT
GCCGCAGTCCGACCTTTCCTCCCTGTCCCCTGACCACTCTGGAGAACTTCCATGA
 Primer design