SecReT4
Protein ID: 121605390
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2494
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2630954..2631538 [+]
Productlytic transglycosylase catalytic subunit
Component typeTrbN
UniProt IDA1VQ70
KEGG IDpna:Pnap_2494
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|121605390|ref|YP_982719.1| lytic transglycosylase catalytic subunit [Polaromonas naphthalenivorans CJ2]
MLELLMMCAPAVDPVTMAAVVKQESGGQPWVVNNNTTRKSMAFASKAVAVAAAVAAVGRGESVDMGLAQI
NSKNLPALGLTVEQVFDPCTNIAAGANILAASYGRAGSLGGALSMYNTGRFDSKIGATYAQKVFGQAGEK
VPRIPGGQLAKLPETSSFAANPAAMAAVRLTVTPSPFAAGLSPVRTALQPANWR
 
Nucleotide Sequence: 585 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2630954-2631538 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
GTGCTTGAGCTCTTGATGATGTGTGCACCCGCCGTCGATCCGGTCACCATGGCCGCTGTTGTGAAGCAGG
AATCCGGCGGCCAGCCCTGGGTGGTCAACAACAACACGACAAGAAAATCAATGGCCTTTGCGTCCAAAGC
TGTGGCCGTGGCCGCTGCGGTGGCGGCTGTCGGCCGTGGCGAAAGTGTTGATATGGGGTTGGCGCAAATC
AATAGCAAAAATTTGCCCGCGCTGGGGCTGACTGTGGAACAGGTGTTCGACCCCTGCACCAACATTGCTG
CCGGGGCAAACATTCTGGCTGCGAGCTATGGAAGAGCCGGCTCGCTCGGCGGCGCCCTGAGCATGTACAA
CACCGGCCGGTTTGATTCAAAAATCGGCGCTACCTACGCCCAAAAGGTGTTCGGACAAGCCGGGGAAAAG
GTACCCAGAATACCGGGTGGGCAACTGGCAAAACTGCCTGAAACGTCTTCTTTTGCAGCCAACCCTGCCG
CCATGGCGGCCGTGCGACTGACGGTTACGCCGTCGCCGTTTGCTGCCGGGCTTTCGCCCGTGAGGACGGC
TTTACAGCCCGCAAATTGGCGTTGA
 Primer design