SecReT4
Protein ID: 121605393
T4SS name [ID]Trb [261]
Gene symbol-
Locus tagPnap_2497
StrainPolaromonas naphthalenivorans CJ2
Repliconchromosome [GenBank: NC_008781] [Browse all T4SS(s) in this replicon]
Location [Strand]2632633..2633598 [+]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDA1VQ73
KEGG IDpna:Pnap_2497
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-78, Aligned region: 29..294
FtsK_SpoIIIE [PF01580], Evalue: 2.1e-05, Aligned region: 138..194
Zeta_toxin [PF06414], Evalue: 4.9e-05, Aligned region: 146..188
Protein Sequence: 321 a.a.     [Download]
>gi|121605393|ref|YP_982722.1| type II secretion system protein E [Polaromonas naphthalenivorans CJ2]
MSTHQNTSSHEFHRRSDDALRRALGADILAALADDRVVEIMLNPSGDLWTDSHVGGMQCIGKIDRVRAMA
IVATVAAMLGTTVTPDNPILECELPLDGSRFEALIPPVVPAPTFALRKKATLIFSLADYVRTGVMTELQA
TLIKTAVADRKNILIAGGTGSGKTTLANAVLNEISFISPDHRIVIIEDVLELQCSVKNTVFLRTSANIDQ
VGLLRATLRLRPDRIVVGEVRDKSALALLKAWNTGHPGGIGTVHANSTGTALVRIGQLIQEAGVPAAPEL
ISEAVNMVISIRRNSTGRIIDEVAEVTNWSSAIGFELRRLG
 
Nucleotide Sequence: 966 bp     [Download]
>gi|121602919|ref|NC_008781.1|:2632633-2633598 Polaromonas naphthalenivorans CJ2 chromosome, complete genome
ATGAGCACACACCAGAACACGTCCAGCCATGAGTTCCACCGCAGGTCGGACGATGCACTGCGGCGCGCCC
TCGGCGCTGACATCCTGGCCGCCCTGGCTGATGACCGGGTGGTAGAGATCATGCTAAACCCGTCGGGCGA
CCTCTGGACTGACTCCCATGTAGGCGGGATGCAATGCATTGGCAAGATTGACCGTGTACGAGCCATGGCG
ATTGTTGCCACGGTGGCGGCCATGCTGGGTACCACGGTCACACCTGACAACCCGATTTTGGAATGCGAGT
TGCCCTTGGATGGTTCGCGGTTTGAAGCCTTGATTCCACCGGTTGTGCCAGCGCCAACTTTTGCCCTTAG
AAAAAAGGCAACATTGATTTTTAGCCTGGCTGACTATGTTCGGACCGGGGTGATGACTGAGCTGCAAGCC
ACATTGATCAAAACGGCGGTTGCAGACAGAAAAAATATCCTGATTGCCGGGGGCACTGGCTCTGGCAAAA
CGACTTTAGCCAATGCCGTCTTGAATGAGATTTCTTTCATATCACCTGATCACAGAATCGTCATTATTGA
AGACGTGTTGGAGCTGCAATGCAGCGTGAAAAACACGGTATTTTTAAGAACATCAGCCAATATTGACCAA
GTTGGTTTATTGCGAGCAACGCTTCGATTAAGACCTGACCGAATTGTTGTGGGTGAGGTCCGGGACAAGT
CGGCTCTGGCGTTGCTGAAGGCATGGAATACGGGGCATCCCGGCGGCATTGGCACCGTCCATGCAAATTC
TACTGGTACAGCCTTGGTCCGAATCGGACAGTTAATTCAAGAAGCGGGTGTGCCTGCGGCACCTGAGTTA
ATCAGCGAAGCGGTCAATATGGTGATATCCATCCGCAGGAATTCCACCGGCCGAATTATTGATGAAGTAG
CTGAAGTAACCAATTGGTCGAGTGCGATTGGTTTTGAGCTGAGACGACTTGGCTAA
 Primer design